country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P0055A

Copy Link Print Information

GLP-1(7-37) acetate

Name: GLP-1(7-37) acetate
Brand: MedChemExpress
SKU: HY-P0055A
Price: 280.00 USD
Availability: InStock
Rating: 5 (10 reviews)

10 Cited Publications

Customer Review

Based on 10 publication(s) in Google Scholar

GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

For research use only. We do not sell to patients.

Purity : 99.59%
CAS No.: 1450806-98-0
Formula: C₁₅₁H₂₂₈N₄₀O₄₇.xC₂H₄O₂
Molecular Weight:3355.67 (free base)

Storage:

Sealed storage, away from moisture and light.

Powder -80°C, 2 years , -20°C, 1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

GLP-1(7-37) acetate Chemical Structure

CAS No.: 1450806-98-0

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- In Vivo
Chemical Information
Publications (10)
Solvent & Solubility
- In Vitro
- In Vivo
Protocols (2)
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion^[1].

In Vivo

GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats^[2].
Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:

Male Sprague-Dawley rats weighing 300 to 350 g with glucose IV at a variable rate for 7 hours to maintain plasma glucose concentration at 11 mM^[2].
Dosage:

5 pmol/min/kg.
Administration:

IV from 1 hour through 7 hours^[2].
Result:

Produced a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle.

Animal Model:

Male Sprague-Dawley rats weighing 300 to 350 g with maintained plasma glucose concentration at 11 mM^[2].
Dosage:

0.5, 5 or 50 pmol/min/kg.
Administration:

IV during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp.
Result:

Produced a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion.

Chemical Information

CAS No. 1450806-98-0
Appearance Solid
Molecular Weight 3355.67 (free base)
Formula C₁₅₁H₂₂₈N₄₀O₄₇.xC₂H₄O₂
Color White to off-white
Sequence

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder	-80°C	2 years
	-20°C	1 year

* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Publications (10)

All Bio/Physico-chemical Assay

Sort by:

Journal Impact Factor

J Med Chem

Discovery and Preclinical Evaluation of TPM003: A Novel GLP-1/GIP/Glucagon Triple Hormone Receptor Agonist with Robust Efficacy in Obesity and NASH. [Abstract]

2026 Feb 26;69(4):4984-5001. PMID: 41640214

GLP-1(7-37) acetate purchased from MedChemExpress. Usage Cited in: J Med Chem. 2026 Feb 26;69(4):4984-5001. [Abstract]

Concentration response curves of the hit peptides in receptor activation at human GLP-1R, compared with RETA. Human GLP-1(7–37), GIP, and glucagon were selected as positive controls toward their corresponding receptors and generally referred to as NL (native ligands) toward each receptor activation assay.
ACS Med Chem Lett

In Vitro Characterization of Agonist and Antagonist Peptide Binding Interaction Kinetics to GLP-1R in HEK293T Cells Using Surface Plasmon Resonance Microscopy. [Abstract]

2026 May 4;17(5):963-972. PMID: 42157826
Pharmaceutical Fronts

2025; 07(02): e126-e136
Patent

US12233112.
Patent

US12233110.
Patent

US12233111.
Patent

US20230278991A1.
Patent

US20230257369A1.
Patent

US20200283424A1.
Patent

US20200283424A1.

Solvent & Solubility

In Vitro:

H₂O : 50 mg/mL (ultrasonic and adjust pH to 1 with HCl)

View the Complete Stock Solution Preparation Table

In Vivo:

Working Solution

For the following dissolution methods, please prepare the working solution directly:

It is recommended to prepare fresh solutions and use them promptly within a short period of time.

The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.

Protocol 1

Add each solvent one by one: PBS

Solubility: 2 mg/mL; Clear solution; Need ultrasonic

Protocols

All Signal Pathway Related Cell Biology

Research Protocol for Endocrine Diseases
Endocrine diseases often arise from disrupted hormone production, hormone signaling, or target-tissue responsiveness; for diabetes-focused endocrine disease models, insulin signaling regulates glucose uptake, hepatic glucose output, lipid metabolism, and β-cell compensation. Type 2 diabetes develops through interacting defects in insulin resistance, β-cell dysfunction, adipose inflammation, hepatic glucose overproduction, altered incretin signaling, and ectopic lipid metabolism. A major unresolved question is whether endocrine dysfunction is driven primarily by target-tissue insulin resistance, intrinsic β-cell failure, immune/inflammatory stress, or combined multi-organ failure that differs by disease stage.
Human Islet Cell Culture
The method of preserving islets in vitro, with purified reduced immunogenicity. The steps are islet isolation, islet cell purification, in vitro determination of islet function and islet cell culture.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (285 KB)
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004). [Content Brief]

[2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

GLP-1(7-37) acetate

10 Cited Publications

100 mg Get Quote

Subscribe to the

MedChemExpress

Newsletter

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote

Amount: USD 0.00

Biological Activity
- Description
- In Vivo
Chemical Information
Publications (10)
Solvent & Solubility
- In Vitro
- In Vivo
Protocols
Purity & Documentation
References

1/16
1/16

GLP-1(7-37) acetate purchased from MedChemExpress. Usage Cited in: J Med Chem. 2026 Feb 26;69(4):4984-5001. [Abstract]

Customer Validation
Concentration response curves of the hit peptides in receptor activation at human GLP-1R, compared with RETA. Human GLP-1(7–37), GIP, and glucagon were selected as positive controls toward their corresponding receptors and generally referred to as NL (native ligands) toward each receptor activation assay.

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Product Name:
CAS No.:
Species:
Purity:
Quantity:

GLP-1(7-37) acetate

Publications Citing Use of MedChemExpress (MCE) GLP-1(7-37) acetate