Bacterial
Anything that destroys bacteria or suppresses their growth or their ability to reproduce. Heat, chemicals such as chlorine, and antibiotic drugs all have antibacterial properties. Many antibacterial products for cleaning and handwashing are sold today. Such products do not reduce the risk for symptoms of viral infectious diseases in otherwise healthy persons. This does not preclude the potential contribution of antibacterial products to reducing symptoms of bacterial diseases in the home.
All Product Categories
-
Bacterial Inhibitors
(7483)
View all products
-
Bacterial Agonists
(3)
View all products
-
Bacterial Antagonists
(9)
View all products
-
Bacterial Activators
(23)
View all products
-
Bacterial Modulators
(23)
View all products
-
Bacterial Chemicals
(2)
View all products
-
Bacterial Inducers
(7)
View all products
-
Bacterial Controls
(14)
View all products
-
Bacterial Substrates
(2)
View all products
-
Bacterial Ligand
(1)
View all products
-
Bacterial Related Products (8800)
Related Products (8800)
-
Antibodies (14)
-
Related Compound Screening Libraries (1)
-
Sideroxylin
0 ImagesSideroxylin is a C-methylated flavone isolated from Callistemon lanceolatus and exerts antimicrobial activity against Staphylococcus aureus. Sideroxylin inhibits ovarian cancer cell proliferation and induces apoptosis, causing DNA fragmentation, depolarization of the mitochondrial membrane, the generation of reactive oxygen species (ROS).
-
Oxyphenbutazone monohydrate
0 ImagesOxyphenbutazone monohydrate is a Phenylbutazone (HY-B0230) metabolite, with anti-inflammatory effect. Oxyphenbutazone monohydrate is an orally active non-selective COX inhibitor. Oxyphenbutazone monohydrate selectively kills non-replicating Mycobaterium tuberculosis.
-
Cassiaside B
0 ImagesCassiaside B, a naphthopyrone, has potent antimicrobial activity.
-
Bombinin-like peptide 7
0 ImagesSynonyms: BLP-7; Maximin 6Bombinin-like peptide 7 is an antimicrobial peptide derived from Bombina orientalis.
-
Defensin HNP-3 human
0 ImagesCat. No.: HY-P2302CAS No.: 136661-76-2Defensin HNP-3 human is an α-defensin stored in the azurophilic granules of human neutrophils. Defensin HNP-3 human exerts broad-spectrum bactericidal, antifungal and antiviral activities mainly by forming bacterial membrane pores, and acts as a chemoattractant for monocytes and T cells. Defensin HNP-3 human maintains epithelial integrity to support periodontal tissue homeostasis, and exerts concentration-dependent effects on epithelial cell proliferation, adhesion and bacterial adhesion. Defensin HNP-3 human targets solid tumors and leukemia by inducing single-strand DNA breaks and membrane permeabilization in tumor cells via electrostatic binding and pore formation. Defensin HNP-3 human is abundant in human tongue squamous cell carcinoma and neutrophils infiltrating oral squamous cell carcinoma. Defensin HNP-3 human can be applied to research related to periodontitis and human tongue squamous cell carcinoma.
-
Cefazolin (Standard)
0 ImagesSynonyms: Cephazolin (Standard)Cefazolin (Standard) is the analytical standard of Cefazolin. This product is intended for research and analytical applications. Cefazolin (Cephazolin) is a first-generation cephalosporin antibiotic and can be used in varieties of bacterial infections research. Cefazolin has anti-inflammatory effect and can attenuate post-operative cognitive dysfunction (POCD).
-
JO146
0 ImagesJO146 is an anti-chlamydial agent, Antibacterial agent, and CtHtrA serine protease inhibitor, with an IC50 of 21.86 μM against CtHtrA serine protease. JO146 alters the morphology of chlamydial cells, reduces inclusion vacuoles, decreases the number of infectious progeny, and eliminates viable Chlamydia trachomatis under stress or conditions that reverse persistent infection. JO146 shows no activity against Escherichia coli, Pseudomonas aeruginosa, and Staphylococcus aureus, but exhibits bactericidal activity against Helicobacter pylori. JO146 can be used in research related to Chlamydia trachomatis infection, chlamydial infection in cattle and sheep, and Helicobacter pylori infection.
-
Caracemide
0 ImagesCat. No.: HY-119974CAS No.: 81424-67-1Synonyms: NSC-253272Caracemide (NSC-253272) inhibits the enzyme ribonucleotide reductase of Escherichia coli. Caracemide is a novel anticancer agent derived from a hydroxamic acid and has demonstrated to produce severe central nervous system (CNS) toxicity.
-
Citronellyl butyrate
0 ImagesCat. No.: HY-W166491CAS No.: 141-16-2Citronellyl butyrate is a terpenoid ester with antibacterial, antifungal and other biological activities. Citronellyl butyrate has inhibitory effects on both Staphylococcus aureus and Escherichia coli. Citronellyl butyrate has inhibitory and bactericidal effects on various strains of Candida albicans (MIC: 156-1250 μg/mL). Citronellyl butyrate can be used in the research of infectious conditions.
-
Olanexidine
0 ImagesCat. No.: HY-125654CAS No.: 146510-36-3Olanexidine is an antibacterial agent. Olanexidine is active against a wide range of bacteria, imcluding both Gram-positive and Gram-negative bacteria Olanexidine is also an antiseptic. Olanexidine can be used in the research of infection and inflammation.
-
Cynaroside (Standard)
0 ImagesSynonyms: Luteolin 7-glucoside (Standard); Luteolin 7-O-β-D-glucoside (Standard)Cynaroside (Standard) is the analytical standard of Cynaroside. This product is intended for research and analytical applications. Cynaroside (Luteolin 7-glucoside) is a flavonoid compound that exhibits anti-oxidative capabilities. Cynaroside is also a potent influenza RNA-dependent RNA polymerase inhibitor with an IC50 of 32 nM. Cynaroside also is a promising inhibitor for H2O2-induced apoptosis, has cytoprotection against oxidative stress-induced cardiovascular diseases. Cynaroside also has antibacterial, antifungal and anticancer activities, antioxidant and anti-inflammatory activities.
-
(3R)-7,4’-Dihydrohomoisoflavanone
0 ImagesCat. No.: HY-N8186CAS No.: 1178893-64-5(3R)-7,4’-Dihydrohomoisoflavanone is a natural product with antibacterial activities against S. aureus and methicillin-resistant Staphylococcus aureus (MRSA).
-
Clindamycin-13C,d3
0 ImagesClindamycin-13C,d3 is the 13C- and deuterium labeled Clindamycin. Clindamycin is an orally active and broad-spectrum bacteriostatic lincosamide antibiotic. Clindamycin can inhibit bacterial protein synthesis, possessing the ability to suppress the expression of virulence factors in Staphylococcus aureus at sub-inhibitory concentrations (sub-MICs). Clindamycin resistance results from enzymatic methylation of the antibiotic binding site in the 50S ribosomal subunit (23S rRNA). Clindamycin decreases the production of Panton-Valentine leucocidin (PVL), toxic-shock-staphylococcal toxin (TSST-1) or alpha-haemolysin (Hla). Clindamycin also can be used for researching malaria.
-
Bactofencin A acetate
0 ImagesCat. No.: HY-P11187APurity: 99.26%Bactofencin A acetate is a class IId bacteriocin and Antibacterial agent. Bactofencin A acetate is produced by Lactobacillus salivarius DPC6502, an isolate derived from the intestine. Bactofencin A acetate exhibits activity against Staphylococcus and Listeria species. Bactofencin A acetate slightly modulates the intestinal flora. Bactofencin A acetate can be used in research related to staphylococcal infections, listerial infections, and mastitis.
-
HYNIC-UBI29-41 TFA
0 ImagesCat. No.: HY-P10913AHYNIC-UBI29-41 TFA is composed of a bifunctional chelator HYNIC and an antimicrobial peptide UBI 29-41 (HY-P10364). HYNIC-UBI29-41 TFA retains the antibacterial properties of UBI 29-41, and exhibits good affinity to Gram-positive and Gram-negative bacteria. HYNIC-UBI29-41 TFA can be used as an imaging agent for bacterial infection detection in mouse models, when labeled with the radioactive element technetium (99mTc).
-
Chrysophanol tetraglucoside
0 ImagesCat. No.: HY-N8206CAS No.: 120181-08-0Chrysophanol tetraglucoside possesses anti-hypolipidemic and antibacterial activities.
-
Benzoxonium chloride (Standard)
0 ImagesCat. No.: HY-127160RCAS No.: 19379-90-9Benzoxonium (chloride) (Standard) is the analytical standard of Benzoxonium (chloride). This product is intended for research and analytical applications. Benzoxonium chloride is an anti-leishmanial agent. Benzoxonium chloride inhibits bacteria, certain protozoa, yeasts and non-spore forming organisms.
-
WLBU2 acetate
0 ImagesCat. No.: HY-P11085APurity: 99.82%WLBU2 acetate is a engineered cationic antimicrobial peptide (eCAP) that overcomes the environmental sensitivity of natural antimicrobial peptides (AMPs). WLBU2 acetate exhibits rapid bactericidal effect, with the MIC values of ≤ 10 μM against both Gram-negative and Gram-positive bacteria including MRSA, vancomycin-resistant enterococci, K. pneumoniae, E.aerogenes, E. cloacae, Escherichia coli, et, al. WLBU2 acetate prevents P. aeruginosa biofilm growth and retains its activity in an environment rich in mucus, low pH and high salt concentrations without negative effects on human airway epithelial cells. WLBU2 acetate can be used for the studies of cystic fibrosis (CF) and Pseudomonas aeruginosa infections.
-
PMAP-36
0 ImagesCat. No.: HY-P10158CAS No.: 154338-08-6Synonyms: Porcine cathelicidin PMAP-36PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance.
