1. GPCR/G Protein Neuronal Signaling
  2. CGRP Receptor
  3. Adrenotensin (human) TFA

Adrenotensin (human) TFA  (Synonyms: Pro-ADM-153-185 (human) TFA)

Cat. No.: HY-P3919A Purity: 99.09%
Handling Instructions Technical Support

Adrenotensin (human) (Pro-ADM-153-185 (human)) TFA is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) TFA is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenotensin (human) TFA

Adrenotensin (human) TFA Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Adrenotensin (human) TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenotensin (human) (Pro-ADM-153-185 (human)) TFA is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) TFA is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones[1].

Molecular Weight

3219.56 (free base)

Formula

C143H224N42O43·xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu

Sequence Shortening

SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenotensin (human) TFA
Cat. No.:
HY-P3919A
Quantity:
MCE Japan Authorized Agent: