country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P3919

Copy Link Print Information

Adrenotensin (human)

(Synonyms: Pro-ADM-153-185 (human))

Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones.

For research use only. We do not sell to patients.

CAS No.: 166546-72-1
Formula: C₁₄₃H₂₂₄N₄₂O₄₃
Molecular Weight:3219.56

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Adrenotensin (human) Chemical Structure

CAS No.: 166546-72-1

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- In Vitro
Chemical Information
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

In Vitro

The human Adrenomedullin (ADM) peptide is encoded by a single gene, which is located on chromosome 11 and consists of four exons and three introns. Translation of the transcript generates the 185 amino acid precursor peptide prepro-ADM, which is subsequently converted into the 164 amino acid pro-ADM by cleavage of the N-terminal signal-peptide. Pro-ADM is further processed into proADM N-terminal 20 peptide (PAMP), midregional pro-ADM, Adrenotensin Pro-ADM-153-185 and immature ADM, a C-terminally glycine-extended version of ADM^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Chemical Information

CAS No. 166546-72-1
Molecular Weight 3219.56
Formula C₁₄₃H₂₂₄N₄₂O₄₃
Synonyms

Pro-ADM-153-185 (human)
Sequence

Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu
Sequence Shortening

SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Ria Schönauer, et al. Adrenomedullin-new perspectives of a potent peptide hormone. J Pept Sci. 2017 Jul;23(7-8):472-485. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote