Adrenotensin (human)
Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones.
For research use only. We do not sell to patients.
- CAS No.: 166546-72-1
- Formula: C143H224N42O43
- Molecular Weight:3219.56
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
In Vitro
The human Adrenomedullin (ADM) peptide is encoded by a single gene, which is located on chromosome 11 and consists of four exons and three introns. Translation of the transcript generates the 185 amino acid precursor peptide prepro-ADM, which is subsequently converted into the 164 amino acid pro-ADM by cleavage of the N-terminal signal-peptide. Pro-ADM is further processed into proADM N-terminal 20 peptide (PAMP), midregional pro-ADM, Adrenotensin Pro-ADM-153-185 and immature ADM, a C-terminally glycine-extended version of ADM[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
CAS No. 166546-72-1
-
Molecular Weight 3219.56
-
Formula C143H224N42O43
-
Synonyms
Pro-ADM-153-185 (human)
-
Sequence
Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu
-
Sequence Shortening
SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)