Dendrotoxin-I
Dendrotoxin-I (DTX-I) is a potent K+ channels blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6, respectively. Dendrotoxin-I, a neurotoxin, has the potential for cancer research.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 107950-33-4
- Formel: C312H491N99O83S6
- Molecular Weight:7149.24
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
|
Kv1.1 0.13-50 nM (IC50) |
Kv1.2 0.13-50 nM (IC50) |
Kv1.6 0.13-50 nM (IC50) |
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Nude mice with MCF-7 cells[3]
-
Dosage:5 mg/kg
-
Administration:IV
-
Result:Displayed a significanttumor growth inhibition effect combined with hyperthermia.
Could not keep on inhibiting the growth of tumor at the later period of treatment.
Chemical Information
-
CAS. Nr. 107950-33-4
-
Molecular Weight 7149.24
-
Formel C312H491N99O83S6
-
Synonyms
DTX-I
-
Sequence
Gln-Pro-Leu-Arg-Lys-Leu-Cys-Ile-Leu-His-Arg-Asn-Pro-Gly-Arg-Cys-Tyr-Gln-Lys-Ile-Pro-Ala-Phe-Tyr-Tyr-Asn-Gln-Lys-Lys-Lys-Gln-Cys-Glu-Gly-Phe-Thr-Trp-Ser-Gly-Cys-Gly-Gly-Asn-Ser-Asn-Arg-Phe-Lys-Thr-Ile-Glu-Glu-Cys-Arg-Arg-Thr-Cys-Ile-Arg-Lys (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
-
Sequence Shortening
QPLRKLCILHRNPGRCYQKIPAFYYNQKKKQCEGFTWSGCGGNSNRFKTIEECRRTCIRK (Disulfide bridge:Cys7-Cys57;Cys16-Cys40;Cys32-Cys53)
-
Structure Classification
-
Initial Source
Dendroaspis polylepis and angusticeps
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
[1]. Qiwen Liao, et al. Novel Kunitz-like Peptides Discovered in the Zoanthid Palythoa caribaeorum through Transcriptome Sequencing. J Proteome Res. 2018 Feb 2;17(2):891-902. [Content Brief]
[2]. Tess Wright, et al. Firing frequency and entrainment maintained in primary auditory neurons in the presence of combined BDNF and NT3. Sci Rep. 2016 Jun 23;6:28584. [Content Brief]
[3]. Hui Zhang, et al. Preparation, characterization, and pharmacodynamics of thermosensitive liposomes containing docetaxel. J Pharm Sci. 2014 Jul;103(7):2177-2183. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)