Leucocin A
Leucocin A (LeuA), a 37-amino acid peptide, is a class II bacteriocin without Lanthionine (HY-135113). Leucocin A has potent anti-bacterial activity against gram-positive bacteria, such as Leuconostoc paramesenteroides and Lactobacillus sake with MICs of 69 and 39 nM, respectively. Leucocin A can be used for infectious diseases research.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Formel: C174H246N52O50S2
- Molecular Weight:3930.26
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Chemical Information
- Protokoll
- Reinheit & Dokumentation
- Verweise
-
Help & FAQs
Biologische Aktivität
Beschreibung
Chemical Information
-
Molecular Weight 3930.26
-
Formel C174H246N52O50S2
-
Synonyms
LeuA
-
Sequence
Lys-Tyr-Tyr-Gly-Asn-Gly-Val-His-Cys-Thr-Lys-Ser-Gly-Cys-Ser-Val-Asn-Trp-Gly-Glu-Ala-Phe-Ser-Ala-Gly-Val-His-Arg-Leu-Ala-Asn-Gly-Gly-Asn-Gly-Phe-Trp (Disulfide bridge: Cys9-Cys14)
-
Sequence Shortening
KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW (Disulfide bridge: Cys9-Cys14)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Protokoll
-
Gram Staining of Tissue Sections
Gram staining of tissue sections is a histochemical technique used to differentiate Gram-positive and Gram-negative bacteria within histological specimens based on differences in bacterial cell wall structure and dye retention, adapted from classical bacteriological Gram staining into tissue-compatible “histological Gram stain” variants. In tissue applications, modifications of the Brown-Hopps and Brown-Brenn methods are commonly used to improve differentiation of microorganisms embedded within host connective tissue and to reduce overstaining or loss of Gram-negative signal, which are known limitations of earlier approaches. The principle relies on crystal violet-iodine complex retention in Gram-positive organisms and subsequent decolorization and counterstaining steps that allow contrast visualization of Gram-negative organisms against tissue background.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Leucocin A Related Classifications
HY-P11134 Related Classifications
Powered by Bioz