2. GPCR/G Protein Stem Cell/Wnt MAPK/ERK Pathway
  3. RXFP Receptor ERK
  4. B7-33

B7-33 is a single-chain relaxin mimetic and a selective relaxin receptor 1 (RXFP1) agonist. B7-33 phosphorylates ERK1/2 without inducing activation of the cAMP signaling pathway. B7-33 exhibits anti-fibrotic and cardioprotective activities. B7-33 can be used in the research of vascular diseases such as cardiomyopathy, myocardial infarction and fibrosis.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

B7-33

B7-33 Chemical Structure

CAS No. : 1818415-56-3

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg In-stock
100 mg   Get quote  
200 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

B7-33 Related Antibodies

Top Publications Citing Use of Products

View All ERK Isoform Specific Products:

View All Isoforms
ERK ERK1 ERK2 ERK5 ERK8

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

B7-33 is a single-chain relaxin mimetic and a selective relaxin receptor 1 (RXFP1) agonist. B7-33 phosphorylates ERK1/2 without inducing activation of the cAMP signaling pathway. B7-33 exhibits anti-fibrotic and cardioprotective activities. B7-33 can be used in the research of vascular diseases such as cardiomyopathy, myocardial infarction and fibrosis[1][2].

In Vitro

B7-33 (10-100 nM) increases the survival rate of primary adult mouse cardiomyocytes subjected to simulated ischemia-reperfusion treatment via an ERK 1/2-dependent mechanism[1].
B7-33 (10-100 nM; 12 h) increases the survival rate of primary adult mouse cardiac fibroblasts subjected to simulated ischemia-reperfusion[1].
B7-33 (10-100 nM) dose-dependently increases the phosphorylation level of ERK1/2 in primary cardiomyocytes of adult mice[1].
B7-33 (100 nM; 24 h) reduces the expression of inflammasome marker ASC and endoplasmic reticulum stress marker GRP78 in adult primary mouse cardiomyocytes subjected to simulated ischemia-reperfusion[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

B7-33 Related Antibodies
In Vivo

B7-33 (0.25 mg/kg; i.p.; twice daily; 7 days) exerts a protective effect in a mouse model of ischemia-reperfusion[1].
B7-33 (0.25 mg/kg; s.c.; 7 days) exerts cardioprotective effects in a mouse model of cardiomyopathy[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: CD1 (male, 6-8 weeks old; with ischemia-reperfusion model)[1]
Dosage: 0.25 mg/kg
Administration: i.p.; twice a day; 7 days
Result: Significantly reduced infarct size and preserved fractional shortening compared with vehicle.
Animal Model: 129sv mice (male, 14-16 weeks old, 25-30 g, Isoprenaline (HY-108353)-induced cardiomyopathy)[2]
Dosage: 0.25 mg/kg
Administration: s.c.; 7 days (days 7-14 post-injury)
Result: Reduced left ventricular (LV) fibrosis, normalized ISO-induced LV inflammation and cardiomyocyte hypertrophy, restored blood vessel density and aortic contractility in the model mice.
Restored α-SMA-stained smooth muscle blood vessel density, VEGF-stained endothelial blood vessel density and CD31-stained capillary density to the normal level.
Blunted the increased aortic contractility to phenylephrine caused by ISO injury.
Molecular Weight

2986.54

Formula

C131H229N41O36S
CAS No.
Appearance

Solid

Color

white

Sequence

Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH2
Sequence Shortening

VIKLSGRELVRAQIAISGMSTWSKRSL-NH2
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Solvent & Solubility
In Vitro: 

H2O : ≥ 20 mg/mL (6.70 mM)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.3348 mL 1.6742 mL 3.3484 mL
5 mM 0.0670 mL 0.3348 mL 0.6697 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Purity & Documentation
References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
H2O 1 mM 0.3348 mL 1.6742 mL 3.3484 mL 8.3709 mL
5 mM 0.0670 mL 0.3348 mL 0.6697 mL 1.6742 mL

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

B7-33 Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

B7-331818415-56-3RXFP ReceptorERKRelaxin family peptideExtracellular signal regulated kinasesprimary mouse cardiac fibroblastsprimary mouse cardiomyocytesmyocardial infarctionmyocardial ischemia-reperfusion injuryInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-33
Cat. No.:
HY-P10728
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

English - EN (252 KB) Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.