GLP-1(7-37) acetate
Based on 10 publication(s) in Google Scholar
GLP-1(7-37) acetate is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.59%
- CAS No.: 1450806-98-0
- Formule: C151H228N40O47.xC2H4O2
- Masse moléculaire:3355.67 (free base)
-
Stockage:
Sealed storage, away from moisture and light.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Activité biologique
-
Chemical Information
-
Solvant et solubilité
- Pureté et documentation
- Références
-
Help & FAQs
Publications Citing Use of MedChemExpress (MCE) GLP-1(7-37) acetate
More- J Med Chem. 2026 Feb 26;69(4):4984-5001. [Abstract]
- ACS Med Chem Lett. 2026 May 4;17(5):963-972. [Abstract]
- Pharmaceutical Fronts. 2025; 07(02): e126-e136
- Patent. US12233112.
- Patent. US12233110.
- Patent. US12233111.
- Patent. US20230278991A1.
- Patent. US20230257369A1.
- Patent. US20200283424A1.
- Patent. US20200283424A1.
Activité biologique
Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male Sprague-Dawley rats weighing 300 to 350 g with glucose IV at a variable rate for 7 hours to maintain plasma glucose concentration at 11 mM[2].
-
Dosage:5 pmol/min/kg.
-
Administration:IV from 1 hour through 7 hours[2].
-
Result:Produced a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle.
-
Animal Model:Male Sprague-Dawley rats weighing 300 to 350 g with maintained plasma glucose concentration at 11 mM[2].
-
Dosage:0.5, 5 or 50 pmol/min/kg.
-
Administration:IV during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp.
-
Result:Produced a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion.
Chemical Information
-
CAS No. 1450806-98-0
-
Appearance Solid
-
Masse moléculaire 3355.67 (free base)
-
Formule C151H228N40O47.xC2H4O2
-
Color White to off-white
-
Sequence
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
-
Sequence Shortening
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture and light
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)
Publications (10)
-
Journal Impact Factor
-
Most Recent
-
J Med Chem
Discovery and Preclinical Evaluation of TPM003: A Novel GLP-1/GIP/Glucagon Triple Hormone Receptor Agonist with Robust Efficacy in Obesity and NASH. [Abstract]2026 Feb 26;69(4):4984-5001. PMID: 41640214 -
ACS Med Chem Lett
In Vitro Characterization of Agonist and Antagonist Peptide Binding Interaction Kinetics to GLP-1R in HEK293T Cells Using Surface Plasmon Resonance Microscopy. [Abstract]2026 May 4;17(5):963-972. PMID: 42157826 -
-
-
-
-
-
-
-
Solvant et solubilité
H2O : 50 mg/mL (ultrasonic and adjust pH to 1 with HCl)
For the following dissolution methods, please prepare the working solution directly:
It is recommended to prepare fresh solutions and use them promptly within a short period of time.
The percentages shown for the solvents indicate their volumetric ratio in the final prepared solution. If precipitation or phase separation occurs during preparation, heat and/or sonication can be used to aid dissolution.
Add each solvent one by one: PBS
Solubility: 2 mg/mL; Clear solution; Need ultrasonic
Pureté et documentation
-
Fiche technique (285 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Sarrauste de Menthiere, C. et al. Structural requirements of the N-terminal region of GLP-1-[7-37]-NH2 for receptor interaction and cAMP production. European journal of medicinal chemistry 39, 473-480, doi:10.1016/j.ejmech.2004.02.002 (2004). [Content Brief]
[2]. Hargrove DM, et al. Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism. 1995 Sep;44(9):1231-7. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
GLP-1(7-37) acetate Related Classifications
HY-P0055A Related Classifications
Powered by Bioz