B7-33
Based on 1 Customer Validation
B7-33 is a single-chain relaxin mimetic and a selective relaxin receptor 1 (RXFP1) agonist. B7-33 phosphorylates ERK1/2 without inducing activation of the cAMP signaling pathway. B7-33 exhibits anti-fibrotic and cardioprotective activities. B7-33 can be used in the research of vascular diseases such as cardiomyopathy, myocardial infarction and fibrosis.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
- Pureté: 99.31%
- CAS No.: 1818415-56-3
- Formule: C131H229N41O36S
- Masse moléculaire:2986.54
-
Stockage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Activité biologique
B7-33 (10-100 nM) increases the survival rate of primary adult mouse cardiomyocytes subjected to simulated ischemia-reperfusion treatment via an ERK 1/2-dependent mechanism[1].
B7-33 (10-100 nM; 12 h) increases the survival rate of primary adult mouse cardiac fibroblasts subjected to simulated ischemia-reperfusion[1].
B7-33 (10-100 nM) dose-dependently increases the phosphorylation level of ERK1/2 in primary cardiomyocytes of adult mice[1].
B7-33 (100 nM; 24 h) reduces the expression of inflammasome marker ASC and endoplasmic reticulum stress marker GRP78 in adult primary mouse cardiomyocytes subjected to simulated ischemia-reperfusion[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
B7-33 (0.25 mg/kg; s.c.; 7 days) exerts cardioprotective effects in a mouse model of cardiomyopathy[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:CD1 (male, 6-8 weeks old; with ischemia-reperfusion model)[1]
-
Dosage:0.25 mg/kg
-
Administration:i.p.; twice a day; 7 days
-
Result:Significantly reduced infarct size and preserved fractional shortening compared with vehicle.
-
Animal Model:129sv mice (male, 14-16 weeks old, 25-30 g, Isoprenaline (HY-108353)-induced cardiomyopathy)[2]
-
Dosage:0.25 mg/kg
-
Administration:s.c.; 7 days (days 7-14 post-injury)
-
Result:Reduced left ventricular (LV) fibrosis, normalized ISO-induced LV inflammation and cardiomyocyte hypertrophy, restored blood vessel density and aortic contractility in the model mice.
Restored α-SMA-stained smooth muscle blood vessel density, VEGF-stained endothelial blood vessel density and CD31-stained capillary density to the normal level.
Blunted the increased aortic contractility to phenylephrine caused by ISO injury.
Chemical Information
-
CAS No. 1818415-56-3
-
Appearance Solid
-
Masse moléculaire 2986.54
-
Formule C131H229N41O36S
-
Color white
-
Sequence
Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH2
-
Sequence Shortening
VIKLSGRELVRAQIAISGMSTWSKRSL-NH2
-
Livraison
Room temperature in continental US; may vary elsewhere.
-
Stockage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvant et solubilité
H2O : ≥ 20 mg/mL (6.70 mM)
* "≥" means soluble, but saturation unknown.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureté et documentation
-
Fiche technique (281 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Références
[1]. Devarakonda T, et al. B7-33, a Functionally Selective Relaxin Receptor 1 Agonist, Attenuates Myocardial Infarction-Related Adverse Cardiac Remodeling in Mice. J Am Heart Assoc. 2020;9(8):e015748. [Content Brief]
[2]. Alam F, et al. The single-chain relaxin mimetic, B7-33, maintains the cardioprotective effects of relaxin and more rapidly reduces left ventricular fibrosis compared to perindopril in an experimental model of cardiomyopathy. Biomed Pharmacother. 2023;160:114370. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.3348 mL | 1.6742 mL | 3.3484 mL | 8.3709 mL |
| 5 mM | 0.0670 mL | 0.3348 mL | 0.6697 mL | 1.6742 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.