FHIT Protein, Human (His)

Avis client

Based on 1 Customer Validation

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
  • Species: Human
  • Source: E. coli
  • Stockage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Activité biologique
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Activité biologique

Description

FHIT protein has multiple enzymatic activities, including dinucleoside triphosphohydrolase, adenylate sulfatase and adenosine 5'-monophosphate amidase, and functions as a tumor suppressor. It regulates CTNNB1-mediated transcriptional activation, affecting key genes such as CCND1 and BIRC5. FHIT Protein, Human (His) is the recombinant human-derived FHIT protein, expressed by E. coli , with C-His labeled tag.

Background

FHIT protein exhibits dinucleoside triphosphate hydrolase activity, specifically cleaving P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to generate AMP and ADP. Additionally, it displays adenylylsulfatase activity, hydrolyzing adenosine 5'-phosphosulfate into AMP and sulfate, as well as adenosine 5'-monophosphoramidase activity, breaking down purine nucleotide phosphoramidates like adenosine 5'-monophosphoramidate (AMP-NH2) to produce AMP and NH2. Acting as a tumor suppressor, FHIT plays a role in modulating transcriptional activation by CTNNB1, influencing the expression of critical genes related to cell proliferation and survival, such as CCND1 and BIRC5. Furthermore, FHIT participates in apoptosis induction through SRC and AKT1 signaling pathways, inhibits MDM2-mediated proteasomal degradation of p53/TP53, and contributes to p53/TP53-mediated apoptosis. The apoptotic effect may involve FHIT's ability to bind Ap3A or related compounds, and it can also be attributed, in part, to its mitochondrial form, which enhances mitochondrial calcium uptake and sensitizes low-affinity Ca(2+) transporters.

Verified Bioactivity

Measured by its ability to inhibit the proliferation of A549 cells. The ED50 for this effect is 0.1098 ng/mL, corresponding to a specific activity is 9.107×106 units/mg.

Données de validation de MCE

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit the proliferation of A549 cells.The ED50 for this effect is 0.1098 ng/mL , corresponding to a specific activity is 9.107×106 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FHIT (M1-Q147)
      Accession # P49789
    • His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FHIT; AP3A Hydrolase; Fragile Histidine Triad Diadenosine Triphosphatase; FRA3B; Bis(5'-Adenosyl)-Triphosphatase; Fragile Histidine Triad Protein; AP3Aase; Fragile Histidine Triad; Diadenosine 5',5'''-P1,P3-Triphosphate Hydrolase; Truncated Diadenosine Tr

  • AA Sequence

    MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQ

  • Masse moléculaire

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Pureté

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Shipping with dry ice.

Calculators

Calculateur de reconstitution

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculateur de dilution

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtenir un devis En stock

Other size
Obtenir un devis
Please select quantity
Amount: USD 0.00