1. Peptides
  2. Calmodulin Binding Peptide 1

Calmodulin Binding Peptide 1 

Cat. No.: HY-P1805
Handling Instructions

Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca2+ release .

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Calmodulin Binding Peptide 1 Chemical Structure

Calmodulin Binding Peptide 1 Chemical Structure

CAS No. : 104041-80-7

Size Stock
1 mg   Get quote  
5 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca2+ release [1].

Molecular Weight

5301.10

Formula

C₂₃₁H₃₇₃N₆₉O₇₀S₂

CAS No.

104041-80-7

Sequence

{Gly}{Val}{Met}{Pro}{Arg}{Glu}{Glu}{Thr}{Asp}{Ser}{Lys}{Thr}{Ala}{Ser}{Pro}{Trp}{Lys}{Ser}{Ala}{Arg}{Leu}{Met}{Val}{His}{Thr}{Val}{Ala}{Thr}{Phe}{Asn}{Ser}{Ile}{Lys}{Glu}{Leu}{Asn}{Glu}{Arg}{Trp}{Arg}{Ser}{Leu}{Gln}{Gln}{Leu}{Ala}

Sequence Shortening

GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA

Shipping

Room temperature in continental US; may vary elsewhere

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calmodulin Binding Peptide 1
Cat. No.:
HY-P1805
Quantity: