SNX-482
Based on 1 publication(s) in Google Scholar
SNX-482, a peptide, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- Reinheit: 98%
- CAS. Nr.: 203460-30-4
- Formel: C192H274N52O60S7
- Molecular Weight:4495.00
-
Speicherung:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) SNX-482
MoreAlle Calcium Channel Isoform-spezifische Produkte anzeigen
More
Biologische Aktivität
IC50: 30 nM (CaV2.3 channel)[2]
SNX-482 blocks the class E Ca2+ channel with an IC50 of 15-30 nM, using either patch clamp electrophysiology or K+-evoked Ca2+ flux[1].
At low nanomolar concentrations, SNX-482 also blocks a native resistant or R-type Ca2+ current in rat neurohypophyseal nerve terminals, but concentrations of 200-500 nM have no effect on R-type Ca2+ currents in several types of rat central neurons[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
-
Animal Model:Male Sprague-Dawley rats (initially weighing 130-150 g) + Spinal nerve ligation[3]
-
Dosage:0.5 μg/50 μL, 1.5 μg/50 μL, 4 μg/50 μL
-
Administration:Applied directly onto the spinal cord, 14-17 days post-operation
-
Result:Exerted a significant dose-related inhibitory effect on C-fiber evoked responses, Aδ-fiber responses, post-discharge and input measurements.
Inhibited the "wind-up" of neurons.
Chemical Information
-
CAS. Nr. 203460-30-4
-
Appearance Solid
-
Molecular Weight 4495.00
-
Formel C192H274N52O60S7
-
Color White to off-white
-
Sequence
Gly-Val-Asp-Lys-Ala-Gly-Cys-Arg-Tyr-Met-Phe-Gly-Gly-Cys-Ser-Val-Asn-Asp-Asp-Cys-Cys-Pro-Arg-Leu-Gly-Cys-His-Ser-Leu-Phe-Ser-Tyr-Cys-Ala-Trp-Asp-Leu-Thr-Phe-Ser-Asp (Disulfide bridge:Cys7-Cys21;Cys14-Cys26;Cys20-Cys33)
-
Sequence Shortening
GVDKAGCRYMFGGCSVNDDCCPRLGCHSLFSYCAWDLTFSD (Disulfide bridge:Cys7-Cys21;Cys14-Cys26;Cys20-Cys33)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Mol Pain
Characterization of excitatory synaptic transmission in the retrosplenial cortex of adult mice. [Abstract]2025 Jan-Dec:21:17448069251335500. PMID: 40317242
Lösungsmittel & Löslichkeit
H2O : 0.5 mg/mL (0.11 mM; Need ultrasonic and warming)
Reinheit & Dokumentation
-
Data Sheet (300 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Verweise
[1]. R Newcomb, et al. Selective peptide antagonist of the class E calcium channel from the venom of the tarantula Hysterocrates gigas. Biochemistry. 1998 Nov 3;37(44):15353-62. [Content Brief]
[2]. E Bourinet, et al. Interaction of SNX482 with domains III and IV inhibits activation gating of alpha(1E) (Ca(V)2.3) calcium channels. Biophys J. 2001 Jul;81(1):79-88. [Content Brief]
[3]. Elizabeth A Matthews, et al. The Cav2.3 calcium channel antagonist SNX-482 reduces dorsal horn neuronal responses in a rat model of chronic neuropathic pain. Eur J Neurosci. 2007 Jun;25(12):3561-9. [Content Brief]
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)