ADAM12 Protein, Human (HEK293, His)
Based on 1 Customer Validation
ADAM12 Protein significantly contributes to skeletal muscle regeneration, particularly in initiating cell fusion. Its multifaceted involvement extends to forming macrophage-derived giant cells (MGC) and differentiating osteoclasts from mononuclear precursors, showcasing a broader role beyond muscle regeneration. ADAM12 Protein, Human (HEK293, His) is the recombinant human-derived ADAM12 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ADAM12 Protein significantly contributes to skeletal muscle regeneration, particularly in initiating cell fusion. Its multifaceted involvement extends to forming macrophage-derived giant cells (MGC) and differentiating osteoclasts from mononuclear precursors, showcasing a broader role beyond muscle regeneration. ADAM12 Protein, Human (HEK293, His) is the recombinant human-derived ADAM12 protein, expressed by HEK293 , with C-His labeled tag.
Background
ADAM12 protein plays a significant role in skeletal muscle regeneration, particularly during the initiation of cell fusion processes. Additionally, it is implicated in the formation of macrophage-derived giant cells (MGC) and the differentiation of osteoclasts from mononuclear precursors, highlighting its multifaceted involvement in cellular events beyond muscle regeneration.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized ADAM12 Protein, Human (HEK293, His) at 10 μg/mL (100 μl/well) can bind mouse FLRG-His with a linear range of 0.31-1.25 μg/mL.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
O43184 (R29-S513)
-
Molecular Construction
-
N-term
-
ADAM12 (R29-S513)
Accession # O43184 -
10*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ADAM12; Metalloprotease-Disintegrin 12 Transmembrane; ADAM Metallopeptidase Domain 12; Meltrin Alpha; MLTN; ADAM12-OT1; MCMPMltna; ADAM 12; Disintegrin And Metalloproteinase Domain-Containing Protein 12; CAR10; Meltrin-Alpha; MLTNA; A Disintegrin And Meta
-
AA Sequence
RGVSLWNQGRADEVVSASVGSGDLWIPVKSFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCYYHGHVRGYSDSAVSLSTCSGLRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAHELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCDLPEFCTGASPHCPANVYLHDGHS
-
Predicted Molecular Mass
55.2 kDa
-
Molecular Weight
Approximately 27 kDa (propeptide) & 55 kDa (mature form) & 72 kDa (pro form), based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH7.4, 5% Trehalose, 5% Mannitol, 0.01% Tween-80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)