DKK-1 Protein, Mouse (CHO)
Based on 6 publication(s) in Google Scholar
Dkk-1 Protein, Mouse (CHO) is shown to be a potent inhibitor of Wnt signaling and member of dickkopf family.
- Species: Mouse
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Dkk-1 Protein, Mouse (CHO) is shown to be a potent inhibitor of Wnt signaling and member of dickkopf family.
Background
Mature mouse Dkk-1 is a 40 kDa glycosylated protein that shares 86%, 96%, 83% and 82% amino acid (aa) sequence identity with human, rat, rabbit and bovine Dkk-1, respectively. It also shares 41% and 36% aa identity with human Dkk-2 and Dkk-4, respectively[1]. Dkk1 is a secreted Wnt inhibitor and member of a distinct multigene family, this inhibition plays a key role in heart, head and forelimb development during anterior morphogenesis of the embryo[2][3].
Verified Bioactivity
1.The ED50 is <6 μg/mL as measured in stimulation of alkaline phosphatase activity using CCl-226 cells.
2.Measured by its ability to inhibit Wnt3a induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1852 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 5.399×103 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (6)
-
Journal Impact Factor
-
Most Recent
-
J Agric Food Chem
Interaction between the Neuroprotective and Hyperglycemia Mitigation Effects of Walnut-Derived Peptide LVRL via the Wnt3a/β-Catenin/GSK-3β Pathway in a Type 2 Diabetes Mellitus Model. [Abstract]2024 Jul 24;72(29):16204-16220. PMID: 38984968 -
Life Sci
Melatonin rescues glucocorticoid-induced inhibition of osteoblast differentiation in MC3T3-E1 cells via the PI3K/AKT and BMP/Smad signalling pathways. [Abstract]2020 Sep 15:257:118044. PMID: 32622944 -
Eur J Pharmacol
Fisetin alleviates osteoporosis by promoting osteogenesis and suppressing adipogenesis via the Wnt/β-catenin signaling pathway in mice. [Abstract]2026 Jun 11:1030:178974. PMID: 42276194 -
J Mol Med (Berl)
LAMP2A regulates the balance of mesenchymal stem cell adipo-osteogenesis via the Wnt/β-catenin/GSK3β signaling pathway. [Abstract]2023 Jul;101(7):783-799. PMID: 37162558 -
Eur J Pharm Biopharm
Berberine encapsulated PEG-coated liposomes attenuate Wnt1/β-catenin signaling in rheumatoid arthritis via miR-23a activation. [Abstract]2020 Apr:149:170-191. PMID: 32068029 -
Cell Tissue Res
KDELR2 promotes bone marrow mesenchymal stem cell osteogenic differentiation via GSK3β/β-catenin signaling pathway. [Abstract]2024 May;396(2):269-281. PMID: 38470494
Technical Parameters
-
Species Mouse
-
Source CHO
-
Tag Tag Free
-
Accession
O54908 (S30-H272)
-
Molecular Construction
-
N-term
-
DKK-1 (S30-H272)
Accession # O54908 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DKK1; Dickkopf 1 Homolog (Xenopus Laevis); Dickkopf Wnt Signaling Pathway Inhibitor 1; Dickkopf 1 Homolog; SK; Dickkopf-1 Like; DKK-1; Dickkopf-1; Dickkopf-Related Protein 1; HDkk-1; Dickkopf-Like Protein 1; Dkk-1; Dickkopf (Xenopus Laevis) Homolog 1
-
AA Sequence
SATLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH
-
Molecular Weight
Approximately 19-22 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized after extensive dialysis against PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Glinka A, et al. Dickkopf-1 is a member of a new family of secreted proteins and functions in head induction. Nature. 1998 Jan 22;391(6665):357-62. [Content Brief]
[2]. Mukhopadhyay M, et al. Dickkopf1 is required for embryonic head induction and limb morphogenesis in the mouse. Dev Cell. 2001 Sep;1(3):423-34. [Content Brief]
[3]. Niida A, et al. DKK1, a negative regulator of Wnt signaling, is a target of the beta-catenin/TCF pathway. Oncogene. 2004 Nov 4;23(52):8520-6. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)