ER alpha/ESR1 Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ER α/ESR1 protein is a nuclear receptor that plays a critical regulatory role in gene expression, affecting cell proliferation and differentiation. Ligand-dependent transactivation involves binding of homodimers to estrogen response elements or association with transcription factors. ER alpha/ESR1 Protein, Human (His) is the recombinant human-derived ER alpha/ESR1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

ER alpha/ESR1 Protein, a nuclear hormone receptor, plays a pivotal role in the regulation of eukaryotic gene expression, influencing cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves direct homodimer binding to palindromic estrogen response element (ERE) sequences or association with DNA-binding transcription factors like AP-1/c-Jun, c-Fos, ATF-2, Sp1, and Sp3, facilitating ERE-independent signaling. Upon ligand binding, ER alpha undergoes a conformational change, enabling subsequent association with multiprotein coactivator complexes through LXXLL motifs. Mutual transrepression occurs between ER alpha and NF-kappa-B in a cell-type specific manner, leading to decreased NF-kappa-B DNA-binding activity and inhibition of NF-kappa-B-mediated transcription. ER alpha is recruited to NF-kappa-B response elements, displacing coregulators and mediating transcriptional activation synergistically with NF-kappa-B. Moreover, ER alpha participates in membrane-initiated estrogen signaling through various kinase cascades, and is essential for MTA1-mediated transcriptional regulation of BRCA1 and BCAS3. Additionally, ER alpha is involved in the activation of NOS3 and endothelial nitric oxide production. Isoforms lacking specific functional domains are believed to modulate transcriptional activity through competitive ligand or DNA binding, as well as heterodimerization with the full-length receptor. Furthermore, ER alpha binds to ERE and inhibits isoform 1.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human ESR1 is present at 10 μg/mL can bind Anti- ESR1 antibody. The ED50 for this effect is 0.445 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human ESR1 is present at 10 μg/mL can bind Anti- ESR1 antibody. The ED50 for this effect is 0.445 μg/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • ESR1 (M1-Q116)
      Accession # P03372-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    ESR1; Estrogen Receptor Alpha Delta 4*,5,6,7*/654 Isoform; Prev. ESR; Estrogen Receptor Alpha 3*,4,5,6,7,8*/1032 Isoform; ER-Alpha; Estrogen Receptor Alpha 3*,4,5,6,7,8*/1068 Isoform; ER; Estrogen Receptor Alpha 3*,4,5,6,7,8*/984 Isoform; Nuclear Receptor

  • AA Sequence

    MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQ

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Glycine-HCl, 8% sucrose, 0.05% Tween 80, pH 3.5.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00