Copy Link Print Information

IL-1 beta Protein, Mouse

45 Cited Publications
Customer Review

Based on 45 publication(s) in Google Scholar

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions. IL-1 beta Protein, Mouse consists of 152 amino acids (V118-S269) and is expressed in E. coli.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • IL-1 beta Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-1 beta is a potent proinflammatory cytokine expressed by monocytes, macrophages, and dendritic cells. IL-1 beta plays a key role in inflammation and immunologic reactions[1][2]. IL-1 beta Protein, Mouse consists of 152 amino acids (V118-S269) and is expressed in E. coli.

Background

Interleukin-1β (IL-1β) is one of the pro-inflammatory cytokines and is produced and secreted by a variety of cell types although the vast majority of studies have focussed on its production within cells of the innate immune system, such as monocytes and macrophages[1][2].
IL-1β is produced as inactive pro-IL-1β (encoded by pro-Il-1b) in response to inflammatory stimuli, including both microbial products and endogenous danger-associated molecules. IL-1β gene expression and synthesis of pro-IL-1β occurs after activation of pattern recognition receptors (PRRs). Inflammatory stimuli also drive activation of cytosolic CARD and PYHIN domain-containing PRRs that recruit ASC and caspase-1 (Casp-1) to assemble into the multiprotein complex inflammasome. Pro-Casp-1 (encoded by pro-Casp-1), activated by the inflammasome, cleaves pro-IL-1β into the bioactive IL-1β. IL-1β acts in an autocrine/paracrine manner via the type I IL-1 receptor (IL-1R1)[1][2][3].
IL-1β could regulate the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. IL-1β also plays a significant regulator of reproduction in females[1][2][3].

In Vitro

IL-1β (1-15625 pg/mL; 12 hours) dose-dependently increases production of the NF-κB-dependent inflammatory cytokine TNF-α, and a significant effect of IL-1β is observed at concentrations as low as 5 pg/mL in immortalized murine RAW264.7 macrophages[1].
IL-1β (1, 10 and 100 ng/mL; 24 hours) results in a dose-dependent increase of cell proliferation in pig heart cells. IL-1β increases the gene expression of caspase-3, and increases the enzymatic activities of MMP-2 and MMP-9[2].

In Vivo

IL-1β (8 ng; i.p.; daily; for 3 days) rescues Casp1−/− mice, restores survival and reduces lung bacterial load (i.e. days 0, 1, and 2 post-infection) in Chlamydia pneumoniae infected Casp1−/− mice. Yet, mice treated later (days 2, 3 and 4 post-infection) shows significantly increased bacterial counts relative to early-treated mice[3].

Verified Bioactivity

1. The ED50 is <10 pg/mL as measured by the dose-dependent stimulation of mouse D10.G4.1 helper T cells, corresponding to a specific activity of 1.0 × 108 IU/mg.
2. Measured in a proliferation assay using CTLL-2 Mouse Embryonic Fibroblasts Cells. The ED50 is 1.802-2.776 pg/mL, corresponding to a specific activity is >3.602×108 units/mg.
3. Measured in a cell proliferation assay using D10.G4.1 mouse helper T cells. The ED50 for this effect is 2-10 pg/mL.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P10749 (V118-S269)

  • Gene ID
    16176  [NCBI]
  • Molecular Construction
    • N-term
    • IL-1β (V118-S269)
      Accession # P10749
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1

  • AA Sequence

    VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS

  • Predicted Molecular Mass

    17.4 kDa

  • Molecular Weight

    Approximately 16-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 50 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 6.8.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.8, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Jan Petrasek, et al. IL-1 receptor antagonist ameliorates inflammasome-dependent alcoholic steatohepatitis in mice. J Clin Invest. 2012 Oct;122(10):3476-89. [Content Brief]

[2]. Karina Zitta, et al. Interleukin-1beta regulates cell proliferation and activity of extracellular matrix remodelling enzymes in cultured primary pig heart cells. Biochem Biophys Res Commun. 2010 Sep 3;399(4):542-7. [Content Brief]

[3]. Kenichi Shimada, et al. Caspase-1 dependent IL-1β secretion is critical for host defense in a mouse model of Chlamydia pneumoniae lung infection. PLoS One. 2011;6(6):e21477. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a proliferation assay using CTLL-2 Cells. The ED50 for this effect is 2.776 pg/mL, corresponding to a specific activity is 3.602×108 units/mg.

  • 1/16

    IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2025 Dec 15.

    Customer Validation
     Representative immunofluorescence micrographs showing NET formation at the MACRO stages of lung tissue with PBS, rIl-1β（8 ng; ip）, anti-IgG, and anti-Il-1β antibody treatment, respectively. NETs were stained with antibodies against Mpo (red) and H3cit (green), and nuclei were counterstained with DAPI (blue).

  • 1/16

    IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Sep 19:148:157271. [Abstract]

    Customer Validation
     WB analysis of YAP, p-YAP, and nuclear versus cytoplasmic YAP levels in HSCs treated with CM from KCs stimulated with IL-1β (10 ng/mL; 6 h) , with or without AA (8 µM).

  • 1/16

    IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Sep 4;15(1):7712. [Abstract]

    Customer Validation
     Cell viability of mouse primary chondrocytes treated with interleukin-1β (10 ng/mL; 48 h) in the absence or presence of 0, 2, 5, 10 nM 10-HDA .

  • 1/16

    IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci Adv. 2024 Nov 29;10(48):eadp9413. [Abstract]

    Customer Validation
     Expression in SFO after LPS treatment. Changes in fire rates of SFO in response to IL-1β (1 nM) or TNF-α.

  • 1/16

    IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci Adv. 2024 Nov 29;10(48):eadp9413. [Abstract]

    Customer Validation
     Changes in fire rates of SFO and OVLT neurons in response to 1nM IL-1β or TNF-α (a half hour in regular ACSF at 30°C)

  • 1/16

    IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2022 Aug 23;9(1):46. [Abstract]

    Customer Validation
     Pre-osteoclasts were cultured in the presence of C3 or C4 with IL-1β (40 ng/mL; 5 days) . Mature osteoclasts were harvested for TRAP staining.

  • IL-1 beta Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • Experimental Validation Results for IL-1 beta Protein, Mouse
  • IL-1 beta Protein, Mouse Product Image

  • IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Cancer Commun (Lond). 2025 Dec 15.

    Representative immunofluorescence micrographs showing NET formation at the MACRO stages of lung tissue with PBS, rIl-1β（8 ng; ip）, anti-IgG, and anti-Il-1β antibody treatment, respectively. NETs were stained with antibodies against Mpo (red) and H3cit (green), and nuclei were counterstained with DAPI (blue).

  • IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Phytomedicine. 2025 Sep 19:148:157271. [Abstract]

    WB analysis of YAP, p-YAP, and nuclear versus cytoplasmic YAP levels in HSCs treated with CM from KCs stimulated with IL-1β (10 ng/mL; 6 h) , with or without AA (8 µM).

  • IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Nat Commun. 2024 Sep 4;15(1):7712. [Abstract]

    Cell viability of mouse primary chondrocytes treated with interleukin-1β (10 ng/mL; 48 h) in the absence or presence of 0, 2, 5, 10 nM 10-HDA .

  • IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci Adv. 2024 Nov 29;10(48):eadp9413. [Abstract]

    Expression in SFO after LPS treatment. Changes in fire rates of SFO in response to IL-1β (1 nM) or TNF-α.

  • IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Sci Adv. 2024 Nov 29;10(48):eadp9413. [Abstract]

    Changes in fire rates of SFO and OVLT neurons in response to 1nM IL-1β or TNF-α (a half hour in regular ACSF at 30°C)

  • IL-1 beta Protein, Mouse purchased from MedChemExpress. Usage Cited in: Mil Med Res. 2022 Aug 23;9(1):46. [Abstract]

    Pre-osteoclasts were cultured in the presence of C3 or C4 with IL-1β (40 ng/mL; 5 days) . Mature osteoclasts were harvested for TRAP staining.