LILRA2/CD85h/ILT1 Protein, Human (HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The LILRA2/CD85h/ILT1 protein is critical in the innate immune response and recognizes N-terminally truncated immunoglobulins from a variety of pathogenic bacteria and fungi. It interacts with cleaved IgM, IgG3 and IgG4, triggering neutrophil and monocyte activation. LILRA2/CD85h/ILT1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRA2/CD85h/ILT1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LILRA2/CD85h/ILT1 protein is critical in the innate immune response and recognizes N-terminally truncated immunoglobulins from a variety of pathogenic bacteria and fungi. It interacts with cleaved IgM, IgG3 and IgG4, triggering neutrophil and monocyte activation. LILRA2/CD85h/ILT1 Protein, Human (HEK293, His-Avi) is the recombinant human-derived LILRA2/CD85h/ILT1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

LILRA2/CD85h/ILT1 protein plays a crucial role in innate immune responses against microbial infection. It specifically recognizes a subset of N-terminally truncated immunoglobulins resulting from protease cleavage in various pathogenic bacteria and fungi, including L. pneumophila, M. hyorhinis, S. pneumoniae, S. aureus, and C. albicans. The protein binds to epitopes located partly in the variable region of immunoglobulin light chains, requiring the constant region for signaling. LILRA2 interacts with cleaved IgM, IgG3, and IgG4 but does not bind to cleaved IgA1. Activation through the binding of N-terminally truncated immunoglobulins triggers neutrophil activation, leading to the release of various cytokines and chemokines. In monocytes, this activation induces the release of CSF2, CF3, IL6, CXCL8, and CCL3, while down-regulating responses to bacterial lipopolysaccharide (LPS), potentially through the down-regulation of TLR4 expression. Additionally, in eosinophils, ligand binding results in the release of RNASE2, IL4, and leukotriene C4. Importantly, LILRA2 does not bind to class I MHC antigens and exists as a homodimer.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LILRA2 (G24-N449)
      Accession # Q8N149-1
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    LILRA2; Leukocyte Immunoglobulin-Like Receptor 7; Leukocyte Immunoglobulin Like Receptor A2; CD85 Antigen-Like Family Member H; LIR-7; Immunoglobulin-Like Transcript 1; ILT1; Leucocyte Ig-Like Receptor A2; LIR7; Leukocyte Immunoglobulin-Like Receptor Subf

  • AA Sequence

    GHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEAAETLSPSQNKTDSTTTSLGQHPQDYTVEN

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00