MMP-2 Protein, Human (HEK293)
Based on 9 publication(s) in Google Scholar
MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.
Background
The MMP-2 protein, a ubiquitinous metalloproteinase, actively participates in a spectrum of physiological processes, including vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. Beyond its role in degrading extracellular matrix proteins, this protein demonstrates versatility by acting on non-matrix proteins, such as big endothelial 1 and beta-type CGRP, thereby promoting vasoconstriction. Additionally, it cleaves KISS at a Gly-|-Leu bond and appears to play a role in myocardial cell death pathways. By regulating the activity of GSK3beta and cleaving GSK3beta in vitro, it contributes to myocardial oxidative stress. In association with MMP14, MMP-2 is involved in the formation of fibrovascular tissues. Notably, the C-terminal non-catalytic fragment of MMP-2, known as PEX, possesses anti-angiogenic and anti-tumor properties, inhibiting cell migration and adhesion to FGF2 and vitronectin. Furthermore, it serves as a ligand for integrin alpha-v/beta3 on the surface of blood vessels.
Verified Bioactivity
1. Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2 ((HY-131498) and the specific activity is > 1,000 pmol/min/μg. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.)
2. Measured by its binding ability in a functional ELISA. Immobilized Human MMP-2 at 2 μg/mL (100 μl/well) can bind Human TIMP2 hFc and the EC50 is 6.0-30.0 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Assay Procedure
Materials
Assay buffer: 50 mM Tris, 10 mM CaCl2, 150 mM NaCl, 0.05% (w/v) Brij 35, pH 7.5 (TCNB)
Test protein: MMP-2 Protein, Human (HEK293) (HY-P73296)
Substrate: MOCAc-PLGL(Dpa) AR (HY-131498)
Standard:MCA-Pro-Leu-OH
Activator: p-aminophenylmercuric acetate (APMA), dissolved in DMSO to 100 mM
F16 Black Maxisorp Plate
Procedure
1. Dilute Human MMP-2 to 100 μg/mL in assay buffer.
2. Activate Human MMP-2 by adding APMA to a final concentration of 1 mM in assay buffer.
3. Incubate at 37°C for 1 hour.
4. Dilute the activated Human MMP-2 to 0.2 μg/mL in assay buffer.
5. Dilute the substrate to 20 μM in assay buffer.
6. Experimental group: 50 μL of different concentrations of Human MMP-2 protein + 50 μL of 20 μM substrate.
7. Control group: 50 μL of 20 μM substrate + 50 μL of buffer.
8. Read in kinetic mode for 5 minutes at excitation and emission wavelengths of 320 nm and 405 nm, respectively.
9. Calculate Specific Activity:
Specific Activity (pmol/min/μg) = | Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU) |
| amount of enzyme (μg) |
*Adjusted for Control
**Derived using calibration standard
Publications (9)
-
Journal Impact Factor
-
Most Recent
-
-
MMP-2 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2023 Apr 14.
MMP-2 enzyme (5 ng/µL, 37 °C for 1.5 h) is cleaved between glycine and leucine.
MMP-2 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Adv Funct Mater. 2023 Apr 14.
MMP-2 enzyme (3 h, 5 µM, pH 6.0) increased cellular uptake in MDA-MB-231 cells treated with Tat-GFP.
-
ACS Nano
Dual-Enzyme-Instructed Peptide Self-Assembly to Boost Immunogenic Cell Death by Coordinating Intracellular Calcium Overload and Chemotherapy. [Abstract]2025 Jan 14;19(1):488-503. PMID: 39754594 -
ACS Nano
Engineering AIEgens-Tethered Gold Nanoparticles with Enzymatic Dual Self-Assembly for Amplified Cancer-Specific Phototheranostics. [Abstract]2024 Oct 1;18(39):26784-26798. PMID: 39300974 -
Cell Death Dis
Therapeutic efficacy of TMTP1-modified EVs in overcoming bone metastasis and immune resistance in PIK3CA mutant NSCLC. [Abstract]2025 May 6;16(1):367. PMID: 40328748 -
Cancer Lett
Vesicular QSOX1-MMP2 from inflammatory cancer-associated fibroblasts degrades the extracellular matrix to drive colorectal cancer pulmonary dissemination. [Abstract]2026 Sep 28:656:218645. PMID: 42217558 -
J Photochem Photobiol B
Development of a self-assembling aggregation-induced emission nanoprobe for targeted therapy and real-time imaging in non-small cell lung cancer. [Abstract]2026 May:278:113402. PMID: 41793940 -
-
MMP-2 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Research Square Preprint. 2023 Jul 21.
The eCpG release in the ATP + MMP-2 (10nM,8 h) group showed evidently higher intensity compared to all other groups。
MMP-2 Protein, Human (HEK293) purchased from MedChemExpress. Usage Cited in: Research Square Preprint. 2023 Jul 21.
The combination treatment of ATP and MMP-2 (10 nM, 8 h) caused a substantial increase in the eCpG release rate from ACP assembly, which reached around 80% of Lip@AUR-ACP-aptPD-L1 (I: ATP-/MMP-2-, II: ATP-/MMP-2+, III: ATP+/MMP-2-, IV: ATP+/MMP-2+).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P08253-1/NP_004521.1 (A30-C660)
-
Molecular Construction
-
N-term
-
MMP-2 (A30-C660)
Accession # P08253-1/NP_004521.1 -
C-term
-
-
Protein Length
Full Length of Isoform-1 (with Propeptide)
-
Synonyms
MMP2; Matrix Metallopeptidase 2 (Gelatinase A, 72kDa Gelatinase, 72kDa Type IV Collagenase); Prev. CLG4A; Collagenase Type IV-A; Prev. CLG4; Neutrophil Gelatinase; TBE-1; 72 KDa Gelatinase; MMP-2; Gelatinase A; 72 KDa Type IV Collagenase; MMP-II; Matrix Metalloproteinase-2; MONA; Matrix Metalloproteinase 2 (Gelatinase A, 72kDa Gelatinase, 72kDa Type IV Collagenase); Matrix Metallopeptidase 2; Matrix Metalloproteinase-II
-
AA Sequence
APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
-
Molecular Weight
Approximately 72 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 0.05 % Brij-35, 150 mM NaCl, 5 mM CaCl2, 50 mM Tris, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (240 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)