MMP-2 Protein, Human (HEK293)

9 Cited Publications
Customer Review

Based on 9 publication(s) in Google Scholar

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.

Background

The MMP-2 protein, a ubiquitinous metalloproteinase, actively participates in a spectrum of physiological processes, including vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. Beyond its role in degrading extracellular matrix proteins, this protein demonstrates versatility by acting on non-matrix proteins, such as big endothelial 1 and beta-type CGRP, thereby promoting vasoconstriction. Additionally, it cleaves KISS at a Gly-|-Leu bond and appears to play a role in myocardial cell death pathways. By regulating the activity of GSK3beta and cleaving GSK3beta in vitro, it contributes to myocardial oxidative stress. In association with MMP14, MMP-2 is involved in the formation of fibrovascular tissues. Notably, the C-terminal non-catalytic fragment of MMP-2, known as PEX, possesses anti-angiogenic and anti-tumor properties, inhibiting cell migration and adhesion to FGF2 and vitronectin. Furthermore, it serves as a ligand for integrin alpha-v/beta3 on the surface of blood vessels.

Verified Bioactivity

1. Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2 ((HY-131498) and the specific activity is > 1,000 pmol/min/μg. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.)
2. Measured by its binding ability in a functional ELISA. Immobilized Human MMP-2 at 2 μg/mL (100 μl/well) can bind Human TIMP2 hFc and the EC50 is 6.0-30.0 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Assay Procedure

Materials
Assay buffer: 50 mM Tris, 10 mM CaCl2, 150 mM NaCl, 0.05% (w/v) Brij 35, pH 7.5 (TCNB)
Test protein: MMP-2 Protein, Human (HEK293) (HY-P73296)
Substrate: MOCAc-PLGL(Dpa) AR (HY-131498)
Standard:MCA-Pro-Leu-OH
Activator: p-aminophenylmercuric acetate (APMA), dissolved in DMSO to 100 mM
F16 Black Maxisorp Plate

Procedure
1. Dilute Human MMP-2 to 100 μg/mL in assay buffer.
2. Activate Human MMP-2 by adding APMA to a final concentration of 1 mM in assay buffer.
3. Incubate at 37°C for 1 hour.
4. Dilute the activated Human MMP-2 to 0.2 μg/mL in assay buffer.
5. Dilute the substrate to 20 μM in assay buffer.
6. Experimental group: 50 μL of different concentrations of Human MMP-2 protein + 50 μL of 20 μM substrate.
7. Control group: 50 μL of 20 μM substrate + 50 μL of buffer.
8. Read in kinetic mode for 5 minutes at excitation and emission wavelengths of 320 nm and 405 nm, respectively.
9. Calculate Specific Activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MMP-2 (A30-C660)
      Accession # P08253-1/NP_004521.1
    • C-term
  • Protein Length

    Full Length of Isoform-1 (with Propeptide)

  • Synonyms

    MMP2; Matrix Metallopeptidase 2 (Gelatinase A, 72kDa Gelatinase, 72kDa Type IV Collagenase); Prev. CLG4A; Collagenase Type IV-A; Prev. CLG4; Neutrophil Gelatinase; TBE-1; 72 KDa Gelatinase; MMP-2; Gelatinase A; 72 KDa Type IV Collagenase; MMP-II; Matrix Metalloproteinase-2; MONA; Matrix Metalloproteinase 2 (Gelatinase A, 72kDa Gelatinase, 72kDa Type IV Collagenase); Matrix Metallopeptidase 2; Matrix Metalloproteinase-II

  • AA Sequence

    APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

  • Molecular Weight

    Approximately 72 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 0.05 % Brij-35, 150 mM NaCl, 5 mM CaCl2, 50 mM Tris, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00