1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-2
  5. MMP-2 Protein, Human (HEK293)

MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg Get quote
500 μg Get quote
> 500 μg   Get quote  

* Please select Quantity before adding items.

MMP-2 Protein, Human (HEK293) Featured Recommendations:

Top Publications Citing Use of Products

    MMP-2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Adv Funct Mater. 2023 Apr 14.

    MMP-2 enzyme (5 ng/µL, 37 °C for 1.5 h) is cleaved between glycine and leucine.

    MMP-2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Adv Funct Mater. 2023 Apr 14.

    MMP-2 enzyme (3 h, 5 µM, pH 6.0) increased cellular uptake in MDA-MB-231 cells treated with Tat-GFP.

    MMP-2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Research Square Preprint. 2023 Jul 21.

    The eCpG release in the ATP + MMP-2 (10nM,8 h) group showed evidently higher intensity compared to all other groups。

    MMP-2 Protein, Human (HEK293) purchased from MCE. Usage Cited in: Research Square Preprint. 2023 Jul 21.

    The combination treatment of ATP and MMP-2 (10 nM, 8 h) caused a substantial increase in the eCpG release rate from ACP assembly, which reached around 80% of Lip@AUR-ACP-aptPD-L1 (I: ATP-/MMP-2-, II: ATP-/MMP-2+, III: ATP+/MMP-2-, IV: ATP+/MMP-2+).
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    MMP-2 protein is a multifunctional metalloproteinase that actively participates in physiological processes such as vascular remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. In addition to degrading extracellular matrix proteins, it also acts on non-matrix proteins to promote vasoconstriction. MMP-2 Protein, Human (HEK293) is the recombinant human-derived MMP-2 protein, expressed by HEK293 , with tag free.

    Background

    The MMP-2 protein, a ubiquitinous metalloproteinase, actively participates in a spectrum of physiological processes, including vasculature remodeling, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. Beyond its role in degrading extracellular matrix proteins, this protein demonstrates versatility by acting on non-matrix proteins, such as big endothelial 1 and beta-type CGRP, thereby promoting vasoconstriction. Additionally, it cleaves KISS at a Gly-|-Leu bond and appears to play a role in myocardial cell death pathways. By regulating the activity of GSK3beta and cleaving GSK3beta in vitro, it contributes to myocardial oxidative stress. In association with MMP14, MMP-2 is involved in the formation of fibrovascular tissues. Notably, the C-terminal non-catalytic fragment of MMP-2, known as PEX, possesses anti-angiogenic and anti-tumor properties, inhibiting cell migration and adhesion to FGF2 and vitronectin. Furthermore, it serves as a ligand for integrin alpha-v/beta3 on the surface of blood vessels.

    Biological Activity

    1. Measured by its ability to cleave the fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2 ((HY-131498) and the specific activity is > 1,000 pmoles/min/µg. (Activation description: The proenzyme needs to be activated by APMA (HY-148905) for an activated form.)
    2. Measured by its binding ability in a functional ELISA. Immobilized Human MMP-2 at 2 μg/mL (100 μl/well) can bind Human TIMP2 hFc and the EC50 is 6.0-30.0 ng/mL.

    • Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2. The specific activity is 11011 pmol/min/µg, as measured under the described conditions.
    Assay Procedure

    Materials
    Assay buffer: 50 mM Tris, 10 mM CaCl2, 150 mM NaCl, 0.05% (w/v) Brij 35, pH 7.5 (TCNB)
    Test protein: MMP-2 Protein, Human (HEK293) (HY-P73296)
    Substrate: MOCAc-PLGL(Dpa) AR (HY-131498)
    Standard:MCA-Pro-Leu-OH
    Activator: p-aminophenylmercuric acetate (APMA), dissolved in DMSO to 100 mM
    F16 Black Maxisorp Plate

    Procedure
    1. Dilute Human MMP-2 to 100 μg/mL in assay buffer.
    2. Activate Human MMP-2 by adding APMA to a final concentration of 1 mM in assay buffer.
    3. Incubate at 37°C for 1 hour.
    4. Dilute the activated Human MMP-2 to 0.2 μg/mL in assay buffer.
    5. Dilute the substrate to 20 μM in assay buffer.
    6. Experimental group: 50 μL of different concentrations of Human MMP-2 protein + 50 μL of 20 μM substrate.
    7. Control group: 50 μL of 20 μM substrate + 50 μL of buffer.
    8. Read in kinetic mode for 5 minutes at excitation and emission wavelengths of 320 nm and 405 nm, respectively.
    9. Calculate Specific Activity:

         Specific Activity (pmol/min/μg) =

    Adjusted Vmax* (RFU/min) x Conversion Factor ** (pmol/RFU)
    amount of enzyme (μg)

    *Adjusted for Control
    **Derived using calibration standard

    Species

    Human

    Source

    HEK293

    Tag

    Tag Free

    Accession

    P08253-1/NP_004521.1 (A30-C660)

    Gene ID
    Molecular Construction
    N-term
    MMP-2 (A30-C660)
    Accession # P08253-1/NP_004521.1
    C-term
    Protein Length

    Full Length of Isoform-1 Mature Protein

    Synonyms
    72 kDa Type IV Collagenase; Gelatinase A; MMP-2; TBE-1; CLG4A
    AA Sequence

    APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

    Molecular Weight

    Approximately 72-74 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

    Glycosylation
    Yes
    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 0.05 % Brij-35, 150 mM NaCl, 5 mM CaCl2, 50 mM Tris, pH 7.5.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    MMP-2 Protein, Human (HEK293) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    MMP-2 Protein, Human (HEK293)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    MMP-2 Protein, Human (HEK293)
    Cat. No.:
    HY-P73296
    Quantity:
    MCE Japan Authorized Agent: