Copy Link Print Information

Erythropoietin/EPO Protein, Human (CHO)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

Erythropoietin/EPO is a renal cytokine that activates Akt and NF-κB signaling pathways by binding to erythroid progenitor cells EPOR. Erythropoietin/EPO regulates erythroid proliferation and differentiation and inhibits apoptosis. Erythropoietin/EPO also has angiogenic ability comparable to VEGF and can stimulate endothelial cell capillary sprouting. Erythropoietin/EPO can be used in the study of ischemic heart diseases such as anemia in end-stage renal disease. Erythropoietin/EPO Protein, Human (CHO) is a recombinant Erythropoietin/EPO protein expressed in CHO cells with tag-free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Erythropoietin/EPO Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Erythropoietin/EPO is a renal cytokine that activates Akt and NF-κB signaling pathways by binding to erythroid progenitor cells EPOR. Erythropoietin/EPO regulates erythroid proliferation and differentiation and inhibits apoptosis. Erythropoietin/EPO also has angiogenic ability comparable to VEGF and can stimulate endothelial cell capillary sprouting. Erythropoietin/EPO can be used in the study of ischemic heart diseases such as anemia in end-stage renal disease. Erythropoietin/EPO Protein, Human (CHO) is a recombinant Erythropoietin/EPO protein expressed in CHO cells with tag-free.

Background

Erythropoietin/EPO is a glycoprotein mainly produced by the kidney and belongs to the cytokine superfamily. Erythropoietin/EPO binds to the erythropoietin receptor (EPOR) on erythroid progenitor cells (CFU-E and BFU-E), activates signaling pathways such as Akt and NF-κB, regulates erythrocyte proliferation and differentiation, promotes cell survival and inhibits apoptosis. Erythropoietin/EPO also has pro-angiogenic potential comparable to VEGF, can stimulate endothelial cell capillary sprouting, and protect tissues from ischemia-reperfusion injury by reducing apoptosis and inflammation. Clinically, recombinant human Erythropoietin/EPO (rh-EPO) can be used to study the inhibition of anemia in end-stage renal disease, and has potential application value in ischemic heart disease, nervous system damage and therapeutic angiogenesis.

Verified Bioactivity

The ED50 is <3 ng/mL as measured in a cell proliferation assay using TF-1 human erythroleukemic cells, corresponding to a specific activity of >3.33× 105 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.136 ng/mL, corresponding to a specific activity is 8.803×105 U/mg

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P01588 (A28-R193)

  • Gene ID
    2056  [NCBI]
  • Molecular Construction
    • N-term
    • EPO (A28-R193)
      Accession # P01588
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    EPO; ECYT5; Erythropoietin; MVCD2; EP; DBAL; Epoetin

  • AA Sequence

    APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

  • Predicted Molecular Mass

    18.4 kDa

  • Molecular Weight

    Approximately 26-36 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Calvillo L, et al. Recombinant human erythropoietin protects the myocardium from ischemia-reperfusion injury and promotes beneficial remodeling. Proc Natl Acad Sci U S A. 2003 Apr 15;100(8):4802-6. [Content Brief]

[2]. Jaquet K, et al. Erythropoietin and VEGF exhibit equal angiogenic potential. Microvasc Res. 2002 Sep;64(2):326-33. [Content Brief]

[3]. Stephenson JR, et al. Induction of colonies of hemoglobin-synthesizing cells by erythropoietin in vitro. Proc Natl Acad Sci U S A. 1971 Jul;68(7):1542-6. [Content Brief]

[4]. Kato M, et al. Pharmacokinetics and pharmacodynamics of recombinant human erythropoietin in rats. Arzneimittelforschung. 2001 Jan;51(1):91-5. [Content Brief]

[5]. Kato M, et al. Mechanism for the nonlinear pharmacokinetics of erythropoietin in rats. J Pharmacol Exp Ther. 1997 Nov;283(2):520-7. [Content Brief]

View More

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is 1.136 ng/mL, corresponding to a specific activity is 8.803×105 U/mg

  • 1/16

    Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Customer Validation
     Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1-9 U/g; s.c.; once daily) upregulated the expression of EPOR in the hippocampus of septic rats. Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1 U/g) induced an additional increase of βCR, whereas high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (9 U/g) displayed a significant decrease in βCR expression.

  • 1/16

    Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Customer Validation
     Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1-9 U/g; s.c.; once daily) significantly increased βCR expression and the number of Iba1+βCR+ cells in the hippocampus of septic rats compared to the CLP group, while high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) significantly decreased them.

  • 1/16

    Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Customer Validation
     Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1 μg/mL) significantly inhibited IL-6 release and enhanced IL-10 expression in microglial cells, while high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1 μg/mL) exhibited the opposite trend.

  • 1/16

    Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Customer Validation
     Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) enhanced βCR and EPOR expression levels in BV2 cells. In contrast, high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) decreased βCR expression while exerting no significant effect on EPOR expression.

  • 1/16

    Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Customer Validation
     Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) decreased the proportion of Iba1+CD86+ (M1 phenotype) cells while increasing that of Iba1+CD206+ (M2 phenotype) cells. However, high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) significantly promoted the M1 polarization of microglia but did not significantly affect the M2 microglia population.

  • Erythropoietin/EPO Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Experimental Validation Results for Erythropoietin/EPO Protein, Human (CHO)
  • Erythropoietin/EPO Protein, Human (CHO) Product Image

  • Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1-9 U/g; s.c.; once daily) upregulated the expression of EPOR in the hippocampus of septic rats. Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1 U/g) induced an additional increase of βCR, whereas high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (9 U/g) displayed a significant decrease in βCR expression.

  • Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1-9 U/g; s.c.; once daily) significantly increased βCR expression and the number of Iba1+βCR+ cells in the hippocampus of septic rats compared to the CLP group, while high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) significantly decreased them.

  • Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1 μg/mL) significantly inhibited IL-6 release and enhanced IL-10 expression in microglial cells, while high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (1 μg/mL) exhibited the opposite trend.

  • Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) enhanced βCR and EPOR expression levels in BV2 cells. In contrast, high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) decreased βCR expression while exerting no significant effect on EPOR expression.

  • Erythropoietin/EPO Protein, Human (CHO) purchased from MedChemExpress. Usage Cited in: Int Immunopharmacol. 2026 Jan 15:169:116053. [Abstract]

    Erythropoietin/EPO Protein, Human (CHO) (rhEPO) (0.1-1 μg/mL; 12 h). Low-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) decreased the proportion of Iba1+CD86+ (M1 phenotype) cells while increasing that of Iba1+CD206+ (M2 phenotype) cells. However, high-dose Erythropoietin/EPO Protein, Human (CHO) (rhEPO) significantly promoted the M1 polarization of microglia but did not significantly affect the M2 microglia population.