Copy Link Print Information

IFN-beta Protein, Human (HEK293)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IFN-beta Protein, Human (HEK293)
  • IFN-beta Protein, Human (HEK293) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IFN-beta Protein, Human (HEK293) is a cytokine with immunomodulatory properties.IFN-beta Protein, Human (HEK293) can be used for the study of severe COVID-19 (coronavirus disease), it reduce viral load and improve lung pathology in a marmoset model[3].

Background

Interferon-beta is a cytokine with immunomodulatory properties, and has therapeutic potential for the treatment of ischemic stroke[1]. Interferon-beta (IFN-β) suppresses the production of IFN-γ and induces IL-10, whereas the production of IL-4 is not altered[2].

Verified Bioactivity

The ED50 is <0.1 ng/mL as measured in a proliferation assay using TF-1 cells.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession

    P01574 (M22-N187)

  • Gene ID
    3456  [NCBI]
  • Molecular Construction
    • N-term
    • IFN-beta (M22-N187)
      Accession # P01574
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IFNB1; IFF; Prev. IFNB; Fibroblast Interferon; IFB; IFN-Beta; Interferon Beta; Interferon-Beta; Interferon Beta 1; Interferon, Beta 1, Fibroblast

  • AA Sequence

    MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

  • Molecular Weight

    Approximately 23 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Kuo PC, et al. Interferon-β Modulates Inflammatory Response in Cerebral Ischemia. J Am Heart Assoc. 2016 Jan 8;5(1). [Content Brief]

[2]. Sega S, et al. IFN-beta1a and IFN-beta1b have different patterns of influence on cytokines. Clin Neurol Neurosurg. 2004 Jun;106(3):255-8. [Content Brief]

[3]. Ivan Fan-Ngai Hung,et al.Triple Combination of Interferon beta-1b, Lopinavir-Ritonavir, and Ribavirin in the Treatment of Patients Admitted to Hospital With COVID-19: An Open-Label, Randomised, Phase 2 Trial. Lancet. 2020 May 30;395(10238):1695-1704. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • IFN-beta Protein, Human (HEK293) Product Image
    1/16
  • Experimental Validation Results for IFN-beta Protein, Human (HEK293)
  • IFN-beta Protein, Human (HEK293) Product Image