IL-1RA/IL-1RN Protein, Human
Based on 5 publication(s) in Google Scholar
IL-1RA/IL-1RN Protein, Human is a member of the IL-1 family that binds to IL-1 receptors.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-1RA/IL-1RN Protein, Human is a member of the IL-1 family that binds to IL-1 receptors.
Background
The production of Human Interleukin-1 Receptor Antagonist Protein (IL-1ra) is stimulated by many substances including adherent IgG, other cytokines, and bacterial or viral components. Endogenous IL-1Ra is produced in numerous experimental animal models of disease as well as in human autoimmune and chronic inflammatory diseases. Treatment of human diseases with recombinant human IL-1Ra shows an absence of benefit in sepsis syndrome[1]. IL-1 receptor antagonist (IL-1ra) has provided a tool for blocking IL-1 activity in vivo, leading to a detailed understanding of the role of this cytokine in the inflammatory response[2].
Verified Bioactivity
Measured by its ability to inhibit IL-1 alpha -dependent proliferation in CTLL-2. The ED50 for this effect is 0.6883-1.145 ng /mL in the presence of 50 pg/mL of recombinant porcine IL-1 alpha, corresponding to a specific activity is 8.73×105-1.45×106 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (5)
-
Journal Impact Factor
-
Most Recent
-
MedComm
Macrophages facilitate tumor cell PD-L1 expression via an IL-1β-centered loop to attenuate immune checkpoint blockade. [Abstract]2023 Mar 30;4(2):e242. PMID: 37009412 -
Cell Commun Signal
Neutrophil extracellular traps facilitate liver inflammation/fibrosis progression by entering macrophages and triggering AIM2 inflammasome-dependent pyroptosis. [Abstract]2024 Nov 20;22(1):556. PMID: 39568027 -
J Neuroinflammation
The role of Toll-like receptor 4 in apoptosis of brain tissue after induction of intracerebral hemorrhage. [Abstract]2019 Nov 26;16(1):234. PMID: 31771613 -
Int J Mol Med
Hypercapnia exacerbates the disruption of the blood‑brain barrier by inducing interleukin‑1β overproduction in the blood of hypoxemic adult rats. [Abstract]2020 Aug;46(2):762-772. PMID: 32626911 -
Arthritis Res Ther
2025 Sep 26;27(1):180. PMID: 41013704
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P18510-1 (R26-E177)
-
Molecular Construction
-
N-term
-
IL-1RA (R26-E177)
Accession # P18510-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
IL1RN; IL-1ra; Interleukin 1 Receptor Antagonist; Intracellular Interleukin-1 Receptor Antagonist (IcIL-1ra); ICIL-1RA; Intracellular Interleukin-1 Receptor Antagonist; IL-1RN; Intracellular IL-1 Receptor Antagonist Type II; IL1RA; Type II Interleukin-1 R
-
AA Sequence
RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
-
Predicted Molecular Mass
17.3 kDa
-
Molecular Weight
Approximately 18-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 8% trehalose, 4% mannitol, 50 mM NaCl, 0.05% Tween 80, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
[1]. Arend WP, et al. Interleukin-1 receptor antagonist: role in biology. Annu Rev Immunol. 1998;16:27-55. [Content Brief]
[2]. Nikolic-Paterson DJ, et al. Interleukin-1 receptor antagonism. Semin Nephrol. 1996 Nov;16(6):583-90. [Content Brief]
[3]. Arend WP, et al. Interleukin 1 receptor antagonist. A new member of the interleukin 1 family. J Clin Invest. 1991 Nov;88(5):1445-51. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)