Copy Link Print Information

IL-10 Protein, Human (CHO)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: CHO
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-10 Protein, Human (CHO)
  • Experimental Validation Results for IL-10 Protein, Human (CHO)
  • IL-10 Protein, Human (CHO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-10 Protein, Human (CHO) is a CHO cell derived anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation.

Background

Interleukin 10 (IL-10) is an anti-inflammatory, immunomodulatory cytokine that regulates mucosal inflammation. A promising alternative is interleukin 10 (IL-10), a cytokine with multiple anti-inflammatory and immunoregulatory activities, including inhibition of T-cell/macrophage activation and proinflammatory cytokine synthesis[1]. IL-10, a cytokine possessing strong anti-inflammatory properties, is under investigation for its therapeutic use as an immunosuppressant. The immunosuppressive actions of IL-10 and corticosteroids include inhibition of proinflammatory cytokine production by monocytes and polymorphonuclear leukocytes (IFN-γ, TNF-α, IL-1β, IL-6, GM-CSF) both at the protein and messenger RNA levels and prevention of mitogen-induced T-cell proliferation[2].

Verified Bioactivity

1.The ED50 is <0.2 ng/mL as measured by MC/9 cells.
2.Immobilized human IL10 at 10 μg/mL (100 μl/well) can bind Cynomolgus IL10RA. The ED50 for this effect is 0.2189-1.732 μg/mL.
3. Immobilized Recombinant Human IL10/Interleukin-10 Protein at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant Rhesus IL10RA Protein. The ED50 for this effect is 218.9 ng/mL.

Technical Parameters

  • Species Human
  • Source CHO
  • Tag Tag Free
  • Accession

    P22301 (S19-N178)

  • Gene ID
    3586  [NCBI]
  • Molecular Construction
    • N-term
    • IL-10 (S19-N178)
      Accession # P22301
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL10; TGIF; Interleukin 10; T-Cell Growth Inhibitory Factor; IL-10; Interleukin-10; CSIF; Interleukin Family Protein; Cytokine Synthesis Inhibitory Factor; GVHDS; IL10A; IF2A

  • AA Sequence

    SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

  • Predicted Molecular Mass

    18.7 kDa

  • Molecular Weight

    Approximately 18-19 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Fedorak RN, et al. Recombinant human interleukin 10 in the treatment of patients with mild to moderately active Crohn's disease. The Interleukin 10 Inflammatory Bowel Disease Cooperative Study Group. Gastroenterology. 2000 Dec;119(6):1473-82. [Content Brief]

[2]. Chakraborty A, et al. Pharmacodynamic interaction of recombinant human interleukin-10 and prednisolone using in vitro whole blood lymphocyte proliferation. J Pharm Sci. 2002 May;91(5):1334-42. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized human IL10 at 10 μg/mL (100 μL/well) can bind Cynomolgus IL10RA, The ED50 for this effect is 1.732 μg/mL.

  • IL-10 Protein, Human (CHO) Product Image
    1/16
  • Experimental Validation Results for IL-10 Protein, Human (CHO)
  • Experimental Validation Results for IL-10 Protein, Human (CHO)
  • IL-10 Protein, Human (CHO) Product Image