VEGF165 Protein, Human (HEK293)

20 Cited Publications
Customer Review

Based on 20 publication(s) in Google Scholar

VEGF165 Protein, Human is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF165 Protein is the growth factor that affects the angiogenesis, vasculogenesis and endothelial cell growth. VEGF165 Protein can binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and affects the motor neuron signaling pathway. VEGF165 Protein, Human (HEK293) is a human-derived VEGF165 Protein that can be expressed by HEK293.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

VEGF165 Protein, Human is a Vascular Endothelial Growth Factor A (VEGF-A) isoform. VEGF165 Protein is the growth factor that affects the angiogenesis, vasculogenesis and endothelial cell growth. VEGF165 Protein can binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and affects the motor neuron signaling pathway. VEGF165 Protein, Human (HEK293) is a human-derived VEGF165 Protein that can be expressed by HEK293.

Background

Vascular Endothelial Growth Factor (VEGF) has multiple isoforms, created by alternative splicing or proteolytic cleavage, and characterized by different receptor-binding and matrix-binding properties. These isoforms are known to give rise to a spectrum of angiogenesis patterns marked by differences in branching, which has functional implications for tissues. VEGF-A is a key member of the VEGF family of cytokines, along with VEGF-B, -C, -D, and PlGF. VEGF-A mediates angiogenesis, the expansion of an existing vascular bed by sprouting of new blood vessels. The vegfa gene is translated into a number of splice isoforms, the most notable in humans being VEGF121, VEGF165, and VEGF189[1].

In Vitro

VEGF165 Protein, Human (50 ng/mL, 12-48 h) promotes the proliferation, migration, invasion and tube formation of HUVECs[2].

Verified Bioactivity

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is <15 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED50 this effect is 2.538 ng/mL, corresponding to a specific activity is 3.94×105 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • VEGF165 (A27-R191)
      Accession # P15692-4
    • C-term
  • Protein Length

    Full Length of Isoform-4

  • Synonyms

    VEGFA; Vascular Endothelial Growth Factor A; VEGF; VPF; Vascular Permeability Factor; Vascular Endothelial Growth Factor A, Long Form; VEGF-A; L-VEGF; Vascular Endothelial Growth Factor A121; Vascular Endothelial Growth Factor A165; Vascular Endothelial G

  • AA Sequence

    APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

  • Predicted Molecular Mass

    19.2 kDa

  • Molecular Weight

    Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
5.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00