SCF Protein, Rat (HEK293)
Based on 1 Customer Validation
SCF Protein, Rat (HEK293) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
SCF Protein, Rat (HEK293) is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis.
Background
Stem Cell Factor is a hematopoietic cytokine, triggered by binding to its ligand c-kit, and plays an important role in hematopoiesis, spermatogenesis, and melanogenesis. Stem Cell Factor (SCF) is applied for hematopoietic stem cell mobilization, exvivo stem/progenitor cell expansion, gene therapy, and immunotherapy[1]. Stem Cell Factor regulates cell survival, proliferation, differentiation, and migration in divergent cell types[2].
Verified Bioactivity
Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED50 for this effect is <50 ng/mL, corresponding to a specific activity is >20000 units/mg.
MCE Validation Data
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag Tag Free
-
Accession
P21581-1 (Q26-A189)
-
Molecular Construction
-
N-term
-
SCF (Q26-A189)
Accession # P21581-1 -
C-term
-
-
Protein Length
Full Length of Soluble KIT ligand Chain
-
Synonyms
KITLG; SLF; Prev. MGF; Familial Progressive Hyperpigmentation 2; SCF; Steel Factor; Mast Cell Growth Factor; C-Kit Ligand; Stem Cell Factor; Kit Ligand; DFNA69; SHEP7; Kitl; DCUA; KL-1; FPHH; FPH2; WS2F; KIT Ligand; SF
-
AA Sequence
QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
-
Molecular Weight
Approximately 10-24 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Farhadi B, et al. Construction of pPIC9 Recombinant Vector Containing Human Stem Cell Factor. Adv Pharm Bull. 2013;3(2):303-8. [Content Brief]
[2]. Kim JY, et al. Stem cell factor is a potent endothelial permeability factor. Arterioscler Thromb Vasc Biol. 2014 Jul;34(7):1459-67. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)