Cecropin A
Based on 2 publication(s) in Google Scholar
Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 99.62%
- No. CAS: 80451-04-3
- Fòrmula: C184H313N53O46
- Peso molecular:4003.78
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications Citing Use of MedChemExpress (MCE) Cecropin A
MoreVer todos los productos específicos de isoformas Antibiotic
More
Actividad biológica
Descripciòn
IC50 & Target
Bacterial[2]
In Vitro
Cecropin A shows anticancer activity. Cecropin A (10-50 μM) dose-dependently reduces the viability of HL-60 cells. Cecropin A (30 μM) promotes ROS production, causes mitochondrial membrane potential (Δψm) collapse, and generates morphological changes in nuclear chromatin in HL-60 cells. Cecropin A (30 μM) also leads to an early apoptosis and cuases caspase-independent cell death in HL-60 cells[1]. Cecropin A has cytotoxicity on gram negative bacteria, including A. baumanii (CCARM 12005, CCARM 12035, CCARM 12036, CCARM 12037) with minimal inhibitory concentration (MIC) of 0.5-1 μM. Cecropin A (25 μM) significantly blocks the expression of mTNF-α, mIL-1β, and mMIP-2 mRNA and slightly inhibited the expression of mMIP-1 mRNA in RAW264.7 cells. Cecropin A (0.1, 0.25, 0.5, 1, 2.5, 5 μM) also inhibits NO production and reduces mTNF-α cytokine levels in LPS-stimulated RAW264.7 cells, and exihibits anti-inflammatory activity[2].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
No. CAS 80451-04-3
-
Appearance Solid
-
Peso molecular 4003.78
-
Fòrmula C184H313N53O46
-
Color White to off-white
-
Sequence
Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
-
Sequence Shortening
KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cell Rep
Barceloneic acid A enables Metarhizium robertsii to establish parasitism in insects and mutualism in plants by inhibiting farnesyltransferase. [Abstract]2026 May 28;45(6):117371. PMID: 42213785 -
Probiotics Antimicrob Proteins
The Efficacy of Cecropin Against Multidrug-Resistant Bacteria Is Linked to the Destabilization of Outer Membrane Structure LPS of Gram-Negative Bacteria. [Abstract]2024 Dec 21. PMID: 39708190
Solvente y solubilidad
In Vitro:
H2O : 20 mg/mL (5.00 mM; ultrasonic and adjust pH to 5 with HCl)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Protocolo
Cell Assay[1]
Briefly, 5 × 105 cells/mL in RPMI 1640 supplemented with 10% heat-inactivated FCS are placed onto 96-well plates. Cecropin A is added to cell cultures at a final concentration of 10, 20, 30, 40 and 50 μM and cells are incubated for 24 h at 37°C in a humidified atmosphere with 5% CO2. Then, 20 μL MTT (0.5 mg/mL) is added to each well and the plate is incubated for 4 h at 37°C. The MTT solution is removed and isopropyl alcohol containing 0.04 N hydrochloric acid is added to each well to dissolve the formazan crystal. Absorbance is determined on a spectrophotometric microplate reader at a test wavelength of 550 nm and a reference wavelength of 620 nm. The absorbance of the cells incubated in the absence of cecropin A (untreated cells) is set at 100%. Results are expressed as percentage of cell viability[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Pureza y Documentación
-
Ficha de datos (286 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
[1]. Cerón JM, et al. The antimicrobial peptide cecropin A induces caspase-independent cell death in human promyelocytic leukemia cells. Peptides. 2010 Aug;31(8):1494-503. [Content Brief]
[2]. Lee E, et al. Anti-inflammatory activities of cecropin A and its mechanism of action. Arch Insect Biochem Physiol. 2015 Jan;88(1):31-44. [Content Brief]
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| H2O | 1 mM | 0.2498 mL | 1.2488 mL | 2.4976 mL | 6.2441 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.