country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P5806

Copy Link Print Information

Ergtoxin-1

(Synonyms: ErgTx1)

Ergtoxin-1 is a potassium channel blocker. Ergtoxin-1 is isolated from the venom of the Mexican scorpion Centruroides noxius. Ergtoxin 1 can block ERG-K⁺ channels in nerve, heart and endocrine cells.

Para uso exclusivo en investigación. No vendemos a pacientes.

No. CAS: 304436-85-9
Fòrmula: C₁₉₃H₂₈₇N₅₉O₆₃S₉
Peso molecular:4730.29

Almacenamiento:

Please store the product under the recommended conditions in the Certificate of Analysis.

Ergtoxin-1 Chemical Structure

No. CAS: 304436-85-9

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

Chemical Information

No. CAS 304436-85-9
Peso molecular 4730.29
Fòrmula C₁₉₃H₂₈₇N₅₉O₆₃S₉
Synonyms

ErgTx1
Sequence

Asp-Arg-Asp-Ser-Cys-Val-Asp-Lys-Ser-Arg-Cys-Ala-Lys-Tyr-Gly-Tyr-Tyr-Gln-Glu-Cys-Gln-Asp-Cys-Cys-Lys-Asn-Ala-Gly-His-Asn-Gly-Gly-Thr-Cys-Met-Phe-Phe-Lys-Cys-Lys-Cys-Ala (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41)
Sequence Shortening

DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA (Disulfide bridge:Cys5-Cys23;Cys11-Cys34;Cys20-Cys39;Cys24-Cys41)
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. Scaloni A, et al. Disulfide bridges of ergtoxin, a member of a new sub-family of peptide blockers of the ether-a-go-go-related K+ channel. FEBS Lett. 2000 Aug 18;479(3):156-7. [Content Brief]

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

MOQ

Minimum order quantity

100 mg

Obtener un presupuesto En stock

Other size

Obtener un presupuesto