country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Referencia número: HY-P5803

Copy Link Print Information

Pardaxin P5

Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM.

Para uso exclusivo en investigación. No vendemos a pacientes.

No. CAS: 67995-63-5
Fòrmula: C₁₅₆H₂₅₀N₃₆O₄₇
Peso molecular:3381.87

Almacenamiento:

Please store the product under the recommended conditions in the Certificate of Analysis.

Pardaxin P5 Chemical Structure

No. CAS: 67995-63-5

Tamaño

Precio

Stock

Cantidad

Amount: USD 0.00

* Seleccione Cantidad antes de agregar artículos.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Actividad biológica

Descripciòn

Pardaxin P5 is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM^[1].

Chemical Information

No. CAS 67995-63-5
Peso molecular 3381.87
Fòrmula C₁₅₆H₂₅₀N₃₆O₄₇
Sequence

Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu
Sequence Shortening

GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
Envío

Room temperature in continental US; may vary elsewhere.
Almacenamiento

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureza y Documentación

Select Batch:

Pureza: 99.98%

Assay: 99.98%

ee.: 99.98%

Ficha de datos (257 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instrucciones de manejo (2659 KB)

Referencias

[1]. Naoki Saigo, et al. Electrophysiological Analysis of Antimicrobial Peptides in Diverse Species. ACS Omega. 2019 Aug 6;4(8):13124-13130. [Content Brief]

Calculators

Calculadora de molaridad

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculadora de dilución

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtener un presupuesto En stock

Other size

Obtener un presupuesto