PHI-27 (rat) TFA
Based on 1 Customer Validation
PHI-27 (rat) TFA is a 27 amino acid peptide.PHI-27 (rat) TFA is used to find peptide hormones and other active peptides.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Fòrmula: C136H216N36O41.xC2HF3O2
- Peso molecular:3011.44 (free base)
-
Almacenamiento:
-20°C, sealed storage, away from moisture
* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Descripciòn
Chemical Information
-
Appearance Solid
-
Peso molecular 3011.44 (free base)
-
Fòrmula C136H216N36O41.xC2HF3O2
-
Sequence
His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2
-
Sequence Shortening
HADGVFTSDYSRLLGQISAKKYLESLI-NH2
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
-20°C, sealed storage, away from moisture
* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvente y solubilidad
In Vitro:
H2O : ≥ 100 mg/mL
* "≥" means soluble, but saturation unknown.
Pureza y Documentación
-
Ficha de datos (276 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
PHI-27 (rat) TFA Related Classifications
HY-P3040A Related Classifications
Powered by Bioz