Hainantoxin-IV
Based on 1 Customer Validation
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif.
For research use only. We do not sell to patients.
- Purity: 96.16%
- CAS No.: 651782-02-4
- Formula: C166H257N53O50S6
- Molecular Weight:3987.53
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Chemical Information
-
CAS No. 651782-02-4
-
Appearance Solid
-
Molecular Weight 3987.53
-
Formula C166H257N53O50S6
-
Color White to off-white
-
Synonyms
HNTX-IV
-
Sequence
Glu-Cys-Leu-Gly-Phe-Gly-Lys-Gly-Cys-Asn-Pro-Ser-Asn-Asp-Gln-Cys-Cys-Lys-Ser-Ser-Asn-Leu-Val-Cys-Ser-Arg-Lys-His-Arg-Trp-Cys-Lys-Tyr-Glu-Ile-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31)
-
Sequence Shortening
ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI-NH2 (Disulfide bridge: Cys2-Cys17; Cys9-Cys24; Cys16-Cys31)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
DMSO : 1 mg/mL (0.25 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Purity & Documentation
-
Data Sheet (289 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)