INF7TAT-P55 acetate
Based on 1 Customer Validation
INF7TAT-P55 acetate (P55 acetate) is a polypeptide derived from INF7TAT (HY-P11000) with G1K, G20L and Y22N mutations. INF7TAT-P55 acetate serves as a delivery carrier to deliver preassembled CRISPR ribonucleases into cells for genome editing.
For research use only. We do not sell to patients.
- Purity: 98.14%
- Formula: C182H282N56O48S·xC2H4O2
- Molecular Weight:4054.60 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
INF7TAT-P55 (peptide/RNP molar ratio 10:1; 1 h) acetate enables efficient, gentle peptide-mediated CRISPR RNP delivery with improved editing rates in primary human CD34+ HSPCs and high edited cell yields in primary human T cells, supporting multiple genome editing applications while preserving cell health[1].
MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
Chemical Information
-
Appearance Solid
-
Molecular Weight 4054.60 (free base)
-
Formula C182H282N56O48S·xC2H4O2
-
Color White to off-white
-
Synonyms
P55 acetate
-
Sequence
Lys-Leu-Phe-Glu-Ala-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Leu-Trp-Asn-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg
-
Sequence Shortening
KLFEAIEGFIENGWEGMIDLWNGYGRKKRRQRR
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvent & Solubility
H2O : 2 mg/mL (Need ultrasonic)
Purity & Documentation
-
Data Sheet (279 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)