1. Others
  2. Drug Derivative Biochemical Assay Reagents
  3. INF7TAT-P55

INF7TAT-P55 (P55) is a polypeptide derived from INF7TAT (HY-P11000) with G1K, G20L and Y22N mutations. INF7TAT-P55 serves as a delivery carrier to deliver preassembled CRISPR ribonucleases into cells for genome editing.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

INF7TAT-P55

INF7TAT-P55 Chemical Structure

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of INF7TAT-P55:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

INF7TAT-P55 (P55) is a polypeptide derived from INF7TAT (HY-P11000) with G1K, G20L and Y22N mutations. INF7TAT-P55 serves as a delivery carrier to deliver preassembled CRISPR ribonucleases into cells for genome editing[1].

In Vitro

INF7TAT-P55 (peptide/RNP molar ratio 10:1; 1 h) enables efficient, gentle peptide-mediated CRISPR RNP delivery with improved editing rates in primary human CD34+ HSPCs and high edited cell yields in primary human T cells, supporting multiple genome editing applications while preserving cell health[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4054.60

Formula

C182H282N56O48S

Sequence

Lys-Leu-Phe-Glu-Ala-Ile-Glu-Gly-Phe-Ile-Glu-Asn-Gly-Trp-Glu-Gly-Met-Ile-Asp-Leu-Trp-Asn-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg

Sequence Shortening

KLFEAIEGFIENGWEGMIDLWNGYGRKKRRQRR

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
INF7TAT-P55
Cat. No.:
HY-P10999
Quantity:
MCE Japan Authorized Agent: