LCI peptide
Based on 1 Customer Validation
LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo.
Para uso exclusivo en investigación. No vendemos a pacientes.
- Pureza: 96.00%
- No. CAS: 343593-45-3
- Fòrmula: C259H378N62O69
- Peso molecular:5464.15
-
Almacenamiento:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Actividad biológica
-
Chemical Information
-
Solvente y solubilidad
- Pureza y Documentación
- Referencias
-
Help & FAQs
Actividad biológica
Chemical Information
-
No. CAS 343593-45-3
-
Appearance Solid
-
Peso molecular 5464.15
-
Fòrmula C259H378N62O69
-
Color White to off-white
-
Sequence
Ala-Ile-Lys-Leu-Val-Gln-Ser-Pro-Asn-Gly-Asn-Phe-Ala-Ala-Ser-Phe-Val-Leu-Asp-Gly-Thr-Lys-Trp-Ile-Phe-Lys-Ser-Lys-Tyr-Tyr-Asp-Ser-Ser-Lys-Gly-Tyr-Trp-Val-Gly-Ile-Tyr-Glu-Val-Trp-Asp-Arg-Lys
-
Sequence Shortening
AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK
-
Envío
Room temperature in continental US; may vary elsewhere.
-
Almacenamiento
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Solvente y solubilidad
DMSO : 100 mg/mL (18.30 mM; Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Pureza y Documentación
-
Ficha de datos (287 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instrucciones de manejo (2659 KB)
Referencias
Complete Stock Solution Preparation Table
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
| Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
|---|---|---|---|---|---|
| DMSO | 1 mM | 0.1830 mL | 0.9151 mL | 1.8301 mL | 4.5753 mL |
| 5 mM | 0.0366 mL | 0.1830 mL | 0.3660 mL | 0.9151 mL | |
| 10 mM | 0.0183 mL | 0.0915 mL | 0.1830 mL | 0.4575 mL | |
| 15 mM | 0.0122 mL | 0.0610 mL | 0.1220 mL | 0.3050 mL |
LCI peptide Related Classifications
HY-P5710 Related Classifications
Powered by Bioz