country

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P11134

Copy Link Print Information

Leucocin A

(Synonyms: LeuA)

Leucocin A (LeuA), a 37-amino acid peptide, is a class II bacteriocin without Lanthionine (HY-135113). Leucocin A has potent anti-bacterial activity against gram-positive bacteria, such as Leuconostoc paramesenteroides and Lactobacillus sake with MICs of 69 and 39 nM, respectively. Leucocin A can be used for infectious diseases research.

For research use only. We do not sell to patients.

Formula: C₁₇₄H₂₄₆N₅₂O₅₀S₂
Molecular Weight:3930.26

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Leucocin A Chemical Structure

Size

Price

Stock

Quantity

Sample (0.1mg)

In-stock

(In Japan)

Apply Now

Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability Get Quote Ask For Quote & Lead Time Consult sales personnel for more information Check price and availability

Bulk Inquiry

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

Molecular Weight 3930.26
Formula C₁₇₄H₂₄₆N₅₂O₅₀S₂
Synonyms

LeuA
Sequence

Lys-Tyr-Tyr-Gly-Asn-Gly-Val-His-Cys-Thr-Lys-Ser-Gly-Cys-Ser-Val-Asn-Trp-Gly-Glu-Ala-Phe-Ser-Ala-Gly-Val-His-Arg-Leu-Ala-Asn-Gly-Gly-Asn-Gly-Phe-Trp (Disulfide bridge: Cys9-Cys14)
Sequence Shortening

KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW (Disulfide bridge: Cys9-Cys14)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Fleury Y, et al. Covalent structure, synthesis, and structure-function studies of mesentericin Y 105(37), a defensive peptide from gram-positive bacteria Leuconostoc mesenteroides. J Biol Chem. 1996 Jun 14;271(24):14421-9. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock