VSTx-3
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
For research use only. We do not sell to patients.
- Formula: C182H261N51O51S6
- Molecular Weight:4171.72
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Protocols
- Purity & Documentation
- References
-
Help & FAQs
Biological Activity
Description
Chemical Information
-
Molecular Weight 4171.72
-
Formula C182H261N51O51S6
-
Synonyms
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
-
Sequence
Asp-Cys-Leu-Gly-Trp-Phe-Lys-Gly-Cys-Asp-Pro-Asp-Asn-Asp-Lys-Cys-Cys-Glu-Gly-Tyr-Lys-Cys-Asn-Arg-Arg-Asp-Lys-Trp-Cys-Lys-Tyr-Lys-Leu-Trp (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Sequence Shortening
DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW (Disulfide bridge: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
VSTx-3 Related Classifications
HY-P5916 Related Classifications
Powered by Bioz