country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P5738

Copy Link Print Information

Palicourein

Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC₅₀ value of 0.1 μM and an IC₅₀ value of 1.5 μM.

For research use only. We do not sell to patients.

CAS No.: 331714-57-9
Formula: C₁₅₉H₂₅₀N₄₈O₅₆S₆
Molecular Weight:3922.36

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

Palicourein Chemical Structure

CAS No.: 331714-57-9

Size

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Top Publications Citing

Use of MCE Products

Fluorescent Dye

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- Description
- Cellular Effect
Chemical Information
Purity & Documentation
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

Description

Cellular Effect

Cell Line	Type	Value	Description	References
CEM-SS	EC₅₀	0.1 μM Compound: Palicourein	Antiviral activity against HIV1 RF infected in human CEM-SS cells assessed as inhibition of virus induced cytopathic effect by XTT assay Antiviral activity against HIV1 RF infected in human CEM-SS cells assessed as inhibition of virus induced cytopathic effect by XTT assay	[PMID: 11430013]
CEM-SS	IC₅₀	1.5 μM Compound: Palicourein	Cytotoxicity against human CEM-SS cells by XTT assay Cytotoxicity against human CEM-SS cells by XTT assay	[PMID: 11430013]

Chemical Information

CAS No. 331714-57-9
Molecular Weight 3922.36
Formula C₁₅₉H₂₅₀N₄₈O₅₆S₆
Sequence

Cyclo(Gly-Asp-Pro-Thr-Phe-Cys-Gly-Glu-Thr-Cys-Arg-Val-Ile-Pro-Val-Cys-Thr-Tyr-Ser-Ala-Ala-Leu-Gly-Cys-Thr-Cys-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys-Lys-Arg-Asn) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6)
Sequence Shortening

Cyclo(GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6)
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (258 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. Bokesch HR, et al. A novel anti-HIV macrocyclic peptide from Palicourea condensata. J Nat Prod. 2001 Feb;64(2):249-50. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Keywords

100 mg

Get Quote In-stock