Palicourein
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM.
For research use only. We do not sell to patients.
- CAS No.: 331714-57-9
- Formula: C159H250N48O56S6
- Molecular Weight:3922.36
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Cellular Effect
|
Cell Line
|
Type | Value | Description | References |
|---|---|---|---|---|
| CEM-SS | EC50 |
0.1 μM
Compound: Palicourein
|
Antiviral activity against HIV1 RF infected in human CEM-SS cells assessed as inhibition of virus induced cytopathic effect by XTT assay
Antiviral activity against HIV1 RF infected in human CEM-SS cells assessed as inhibition of virus induced cytopathic effect by XTT assay
|
[PMID: 11430013] |
| CEM-SS | IC50 |
1.5 μM
Compound: Palicourein
|
Cytotoxicity against human CEM-SS cells by XTT assay
Cytotoxicity against human CEM-SS cells by XTT assay
|
[PMID: 11430013] |
Chemical Information
-
CAS No. 331714-57-9
-
Molecular Weight 3922.36
-
Formula C159H250N48O56S6
-
Sequence
Cyclo(Gly-Asp-Pro-Thr-Phe-Cys-Gly-Glu-Thr-Cys-Arg-Val-Ile-Pro-Val-Cys-Thr-Tyr-Ser-Ala-Ala-Leu-Gly-Cys-Thr-Cys-Asp-Asp-Arg-Ser-Asp-Gly-Leu-Cys-Lys-Arg-Asn) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6)
-
Sequence Shortening
Cyclo(GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN) (Disulfide bridge: Cys1-Cys4,Cys2-Cys5,Cys3-Cys6)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Research Protocol for Infectious Diseases
Infectious-disease experiments test how pathogens interact with host barriers, innate immune receptors, inflammatory signaling, pathogen replication, and tissue injury; pattern-recognition receptors such as TLRs, RIG-I-like receptors, NOD-like receptors, and inflammasomes detect microbial molecules and activate NF-κB, interferon, and cytokine responses. The central hypothesis is that infection severity reflects the balance between pathogen burden and host response: protective inflammation restricts pathogen growth, whereas excessive or mislocalized inflammation contributes to tissue damage and disease phenotype. Unresolved questions include which host pathways are protective versus pathogenic, why some infection models fail to translate to human disease, and which combined readouts best predict clinically relevant infection outcomes.
-
Cell Cytotoxicity Assay
Cytotoxicity assays are usually based on the assessment of cell membrane damage, which can also be indirectly detected by measuring cell viability. Detection methods include MTT assay, CKK-8 assay, LDH assay and ATP assay, etc.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)