1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CD Antigens Receptor Proteins Biotinylated Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Cytokine Receptors
  4. TNF Receptor Superfamily
  5. 4-1BB
  6. 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi)

4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi)

Cat. No.: HY-P78794
Handling Instructions Technical Support

4-1BB/TNFRSF9 Protein lacks conserved residue(s) crucial for feature annotation propagation. 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is 188 a.a., with molecular weight of 30-45 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

4-1BB/TNFRSF9 Protein lacks conserved residue(s) crucial for feature annotation propagation. 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is 188 a.a., with molecular weight of 30-45 kDa.

Background

The 4-1BB/TNFRSF9 protein is marked by an absence of conserved residue(s) necessary for the propagation of feature annotation.

In Vitro

4-1BB (hamster ovary; 5 μg/mL; 16 h) costimulates B lymphocyte proliferation[4].

Biological Activity

Immobilized Biotinylated Mouse 4-1BB / TNFRSF9 Avi-His at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Mouse 4-1BB Ligand Fc with a linear range of 0.3-2 ng/mL.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

Q8R037 (V24-L211)

Gene ID
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
TNFRSF9; 4-1BB; CD137; CDw137; ILA
AA Sequence

VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL

Predicted Molecular Mass
24.5 kDa
Molecular Weight

Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi)
Cat. No.:
HY-P78794
Quantity:
MCE Japan Authorized Agent: