4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, isoform 2, HEK293, His-Avi)
4-1BB/TNFRSF9 Protein lacks conserved residue(s) crucial for feature annotation propagation. 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is 188 a.a., with molecular weight of 30-45 kDa.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
4-1BB/TNFRSF9 Protein lacks conserved residue(s) crucial for feature annotation propagation. 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is the recombinant mouse-derived 4-1BB/TNFRSF9 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of 4-1BB/TNFRSF9 Protein, Mouse (Biotinylated, 188a.a, HEK293, His-Avi) is 188 a.a., with molecular weight of 30-45 kDa.
Background
The 4-1BB/TNFRSF9 protein is marked by an absence of conserved residue(s) necessary for the propagation of feature annotation.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-His
-
Accession
Q8R037/NP_001070976 (V24-L211)
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
TNFRSF9; CDw137; Prev. ILA; Tumor Necrosis Factor Receptor Superfamily, Member 9; CD137; Induced By Lymphocyte Activation (ILA); 4-1BB; Homolog Of Mouse 4-1BB; Tumor Necrosis Factor Receptor Superfamily Member 9; Receptor Protein 4-1BB; T-Cell Antigen 4-1BB Homolog; T Cell Antigen ILA; 4-1BB Ligand Receptor; T-Cell Antigen ILA; CD137 Antigen; IMD109; TNF Receptor Superfamily Member 9; Interleukin-Activated Receptor, Homolog Of Mouse Ly63
-
AA Sequence
VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPAFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
-
Predicted Molecular Mass
24.5 kDa
-
Molecular Weight
Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
