4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc)
4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.
Background
The 4-1BBL (TNFSF9) protein is a cytokine with significant immunomodulatory functions, binding to the TNFRSF9 receptor. Its interaction induces the proliferation of activated peripheral blood T-cells, suggesting a role in T-cell activation and immune response amplification. Additionally, 4-1BBL may be involved in activation-induced cell death (AICD), a process that regulates the survival and homeostasis of activated immune cells. Furthermore, the protein might play a role in mediating cognate interactions between T-cells and B-cells/macrophages, contributing to immune cell communication and coordination. Structurally, 4-1BBL forms homotrimers, indicating its organization into trimeric complexes. These diverse functions underscore the pivotal role of 4-1BBL in immune regulation and intercellular communication within the immune system.
In Vitro
4-1BB (human; 1 μg/mL; 16 h) leads to induction of monocyte activation and induces Myc protein production[4].
4-1BB (human; 1 μg/mL; 1 d) prolongs survival of peripheral monocytes and (1 μg/mL; 1 h) induces expression of M-CSF[5].
4-1BB (human; 1.2-4 μg/mL; 7 d) exhibits nhancement of cell numbers dose-dependently[6].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-Myc;N-hFc
-
Accession
P41273 (R71-E254)
-
Molecular Construction
-
N-term
-
hFc-Myc
-
4-1BBL (R71-E254)
Accession # P41273 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
TNFSF9; Homolog Of Mouse 4-1BB-L; TNF Superfamily Member 9; Receptor 4-1BB Ligand; 4-1BBL; CD137 Ligand; 4-1BB-L; 4-1BB Ligand; CD137L; Tumor Necrosis Factor (Ligand) Superfamily, Member 9, Isoform CRA_a; Tumor Necrosis Factor (Ligand) Superfamily, Member
-
AA Sequence
REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
-
Predicted Molecular Mass
48 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)