4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc)

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

4-1BBL/TNFSF9 protein is a cytokine that selectively binds to TNFRSF9 and exerts its effects by inducing the proliferation of activated peripheral blood T cells. As a homotrimer, this ligand demonstrates its potential role in activation-induced cell death (AICD) and may be involved in coordinating homologous interactions between T cells and B cells/macrophages. 4-1BBL/TNFSF9 Protein, Human (HEK293, hFc-Myc) is the recombinant human-derived 4-1BBL/TNFSF9 protein, expressed by HEK293 , with N-Myc, N-hFc labeled tag.

Background

The 4-1BBL (TNFSF9) protein is a cytokine with significant immunomodulatory functions, binding to the TNFRSF9 receptor. Its interaction induces the proliferation of activated peripheral blood T-cells, suggesting a role in T-cell activation and immune response amplification. Additionally, 4-1BBL may be involved in activation-induced cell death (AICD), a process that regulates the survival and homeostasis of activated immune cells. Furthermore, the protein might play a role in mediating cognate interactions between T-cells and B-cells/macrophages, contributing to immune cell communication and coordination. Structurally, 4-1BBL forms homotrimers, indicating its organization into trimeric complexes. These diverse functions underscore the pivotal role of 4-1BBL in immune regulation and intercellular communication within the immune system.

In Vitro

4-1BB (human; 1 μg/mL; 16 h) leads to induction of monocyte activation and induces Myc protein production[4].
4-1BB (human; 1 μg/mL; 1 d) prolongs survival of peripheral monocytes and (1 μg/mL; 1 h) induces expression of M-CSF[5].
4-1BB (human; 1.2-4 μg/mL; 7 d) exhibits nhancement of cell numbers dose-dependently[6].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-Myc;N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc-Myc
    • 4-1BBL (R71-E254)
      Accession # P41273
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    TNFSF9; Homolog Of Mouse 4-1BB-L; TNF Superfamily Member 9; Receptor 4-1BB Ligand; 4-1BBL; CD137 Ligand; 4-1BB-L; 4-1BB Ligand; CD137L; Tumor Necrosis Factor (Ligand) Superfamily, Member 9, Isoform CRA_a; Tumor Necrosis Factor (Ligand) Superfamily, Member

  • AA Sequence

    REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

  • Predicted Molecular Mass

    48 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00