ADCYAP1R1 Protein, Human (HEK293, Fc, solution)

The ADCYAP1R1 protein is a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP) and recognizes PACAP-27 and PACAP-38. Through the G protein, this receptor activates adenylyl cyclase, initiating multiple downstream signaling pathways. ADCYAP1R1 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived ADCYAP1R1 protein, expressed by HEK293 , with C-hFc labeled tag.

The ADCYAP1R1 protein functions as a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP), specifically recognizing both PACAP-27 and PACAP-38. Operating through G proteins, this receptor activates adenylyl cyclase, initiating downstream signaling pathways. It is implicated in the regulation of various hormonal releases, including adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. Additionally, ADCYAP1R1 may play a role in spermatogenesis and sperm motility, contributing to smooth muscle relaxation and secretion in the gastrointestinal tract. Its interaction with PACAP is facilitated through the N-terminal extracellular domain, highlighting its crucial involvement in diverse physiological processes.

Human

HEK293

C-hFc

P41586 (D24-A155)

117  [NCBI]

Partial

DCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKA

Approximately 65 kDa

≥ 85%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.