ADCYAP1R1 Protein, Human (HEK293, Fc, solution)
Based on 1 Customer Validation
The ADCYAP1R1 protein is a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP) and recognizes PACAP-27 and PACAP-38. Through the G protein, this receptor activates adenylyl cyclase, initiating multiple downstream signaling pathways. ADCYAP1R1 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived ADCYAP1R1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The ADCYAP1R1 protein is a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP) and recognizes PACAP-27 and PACAP-38. Through the G protein, this receptor activates adenylyl cyclase, initiating multiple downstream signaling pathways. ADCYAP1R1 Protein, Human (HEK293, Fc, solution) is the recombinant human-derived ADCYAP1R1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The ADCYAP1R1 protein functions as a receptor for pituitary adenylate cyclase-activating polypeptide (PACAP), specifically recognizing both PACAP-27 and PACAP-38. Operating through G proteins, this receptor activates adenylyl cyclase, initiating downstream signaling pathways. It is implicated in the regulation of various hormonal releases, including adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. Additionally, ADCYAP1R1 may play a role in spermatogenesis and sperm motility, contributing to smooth muscle relaxation and secretion in the gastrointestinal tract. Its interaction with PACAP is facilitated through the N-terminal extracellular domain, highlighting its crucial involvement in diverse physiological processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P41586 (D24-A155)
-
Molecular Construction
-
N-term
-
ADCYAP1R1 (D24-A155)
Accession # P41586 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ADCYAP1R1; PAC1 Receptor; ADCYAP Receptor Type I; PACAP-R1; PAC1R; Pituitary Adenylate Cyclase Activating Polypeptide 1 Receptor Type I Hiphop Splice Variant; Pituitary Adenylate Cyclase-Activating Polypeptide Type I Receptor; Pituitary Adenylate Cyclase
-
AA Sequence
DCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYESETGDQDYYYLSVKA
-
Predicted Molecular Mass
42 kDa
-
Molecular Weight
Approximately 65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
