Adiponectin/Acrp30 Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
Adiponectin/Acrp30 Protein is a protein hormone and adipokine, the most abundant peptide secreted by adipocytes, which is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Adiponectin plays a inportant role in obesity-related diseases, insulin resistance/type 2 diabetes and cardiovascular disease. Adiponectin/Acrp30 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Adiponectin/Acrp30 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Adiponectin/Acrp30 Protein is a protein hormone and adipokine, the most abundant peptide secreted by adipocytes, which is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Adiponectin plays a inportant role in obesity-related diseases, insulin resistance/type 2 diabetes and cardiovascular disease. Adiponectin/Acrp30 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Adiponectin/Acrp30 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Adiponectin is a protein hormone and adipokine, which is involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Adiponectin has direct actions in liver, skeletal muscle, and the vasculature.Adiponectin exists in the circulation as varying molecular weight forms, produced by multimerization. Adiponectin enhances insulin sensitivity primarily by regulating fatty acid oxidation and inhibiting hepatic glucose production. It can also promote synaptic and memory function in the brain. Adiponectin stimulates AMPK phosphorylation and activation in the liver and skeletal muscle, enhancing glucose utilization and fatty-acid combustion. At the same time, it antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Adiponectin inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. Adiponectin may play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW[1][2][3][5][6][7].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q60994 (E18-N247)
-
Molecular Construction
-
N-term
-
Acrp30 (E18-N247)
Accession # Q60994 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ADIPOQ; Adipocyte, C1Q And Collagen Domain Containing; Prev. ACDC; Adipose Specific Collagen-Like Factor; Adiponectin; Gelatin-Binding Protein 28; ACRP30; Gelatin-Binding Protein; GBP28; Adiponectin Precursor; ApM1; ADIPQTL1; Adipose Most Abundant Gene Tr
-
AA Sequence
EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
-
Predicted Molecular Mass
51.3 kDa
-
Molecular Weight
Approximately 52-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)