1. Recombinant Proteins
  2. Receptor Proteins
  3. AGER Protein, Human (HEK293)

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. AGER Protein, Human (HEK293) is the recombinant human-derived AGER protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg Get quote
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AGER proteins are cell surface pattern recognition receptors that expertly sense endogenous stress signals utilizing an extensive library of ligands, including advanced glycation end products, S100 proteins, high mobility Group Box 1 proteins/HMGB1, starch Like protein β/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. AGER Protein, Human (HEK293) is the recombinant human-derived AGER protein, expressed by HEK293 , with tag free.

Background

AGER Protein, a cell surface pattern recognition receptor, adeptly senses endogenous stress signals with a wide-ranging ligand repertoire, encompassing advanced glycation end products, S100 proteins, high-mobility group box 1 protein/HMGB1, amyloid beta/APP oligomers, nucleic acids, phospholipids, and glycosaminoglycans. Accumulation of advanced glycosylation end products, especially prevalent in aging and diabetes, triggers inflammatory responses at various disease sites, including diabetes, vascular complications, neurodegenerative disorders, and cancers. RAGE, upon ligand binding, utilizes TIRAP and MYD88 as adapters to transduce signals, ultimately inducing inflammatory cytokines IL6, IL8, and TNFalpha through NF-kappa-B activation. Noteworthy interactions include S100A12-triggered cellular activation, S100B-induced apoptosis post-myocardial infarction, and the facilitation of amyloid-beta peptide translocation in cortical neurons. AGER also plays a role in endothelial albumin transcytosis with HMGB1 through the RAGE/SRC/Caveolin-1 pathway, leading to endothelial hyperpermeability, and mediates the loading of HMGB1 in extracellular vesicles for hepatocyte pyroptosis via the NLRP3 inflammasome. Additionally, it promotes extracellular hypomethylated DNA uptake for the activation of inflammatory responses. The constitutive homodimeric and oligomeric forms, along with interactions with S100 proteins, APP, TIRAP, and HMGB1, highlight the intricate involvement of AGER Protein in various cellular processes and pathological conditions.

Biological Activity

Immobilized Human AGER at 20 μg/mL (100 μL/well) can bind Biotinylated Human HMGB1. The ED50 for this effect is 55.5 ng/mL.

  • Immobilized Human AGER at 20 μg/mL (100 μL/well) can bind Biotinylated Human HMGB1. The ED50 for this effect is 55.5 ng/mL.
Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q15109 (A23-A344)

Gene ID

177  [NCBI]

Molecular Construction
N-term
AGER (A23-A344)
Accession # Q15109
C-term
Protein Length

Partial

Synonyms
Advanced glycosylation end product-specific receptor; Ager; Rage
AA Sequence

AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALA

Molecular Weight

45-60 kDa due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Shipping with dry ice.

Documentation

AGER Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AGER Protein, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AGER Protein, Human (HEK293)
Cat. No.:
HY-P74605
Quantity:
MCE Japan Authorized Agent: