1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. AITRL/TNFSF18 Protein, Mouse

AITRL/TNFSF18 Protein, Mouse

Cat. No.: HY-P7319
Handling Instructions

AITRL/TNFSF18 Protein, Mouse is a single non-glycosylated polypeptide chain produced in E. coli, with a molecular mass of 14.5 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $490 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE AITRL/TNFSF18 Protein, Mouse

AITRL/TNFSF18 Protein, Mouse Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

Q7TS55 (T47-S173)

Gene ID

240873

Synonyms
rMuActivation-inducible TNF-related Ligand/AITRL; TNFSF18; GITRL; TL-6
AA Sequence

TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS

Molecular Weight

Approximately 14.5 kDa

Biological Activity
The ED50 is <5 ng/mL as measured by PMBC, corresponding to a specific activity of >2 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

AITR (Activation-Inducible Tumor necrosis factor Receptor) and AITRL (AITR Ligand) are both costimulatory molecules, which are pairs of molecules that interact with each other and are expressed at high levels on the surface of CD4+CD25+ T cells. When these costimulatory molecules are activated, they inhibit the ability of the CD4+CD25+ T cells to suppress the autoreactive T-cells. This results in an increased autoimmune response[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AITRL/TNFSF18 Protein, Mouse
Cat. No.:
HY-P7319
Quantity:
MCE Japan Authorized Agent: