AlkB Protein, E.coli (Myc, His-SUMO)
Based on 1 Customer Validation
AlkB Protein, E.coli (Myc, His-SUMO) is a protein found in E. coli, plays a major role in oxidative dealkylation processes.
- Species: E.coli
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
AlkB Protein, E.coli (Myc, His-SUMO) is a protein found in E. coli, plays a major role in oxidative dealkylation processes.
Background
Iron-dependent dioxygenases of the AlkB protein family found in most organisms throughout the tree of life play a major role in oxidative dealkylation processes. In higher eukaryotes including yeast, plants and mammals, members of the AlkB family play pivotal roles. In humans, this family draws particular interest because of its involvement in DNA repair and progression of cancer, as they are frequently overexpressed in tumors and counteract the effects of alkylating drugs such as temozolamide used in chemotherapy. The alkylation-sensitive phenotype of E. coli alkB mutants marks the alkB pathway as an extremely effective defense mechanism against the cytotoxic effects of the SN2, but not the SN1, alkylating agents[1][2].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species E.coli
-
Source E. coli
-
Tag N-His;C-Myc;N-SUMO
-
Accession
P05050 (M1-E216)
-
Gene ID946708 [NCBI]
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
AlkB (M1-E216)
Accession # P05050 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
ALKBH1; DNA Lyase ABH1; Prev. ALKBH; AlkB; ABH; ABH1; Alpha-Ketoglutarate-Dependent Dioxygenase ABH1; AlkB, Alkylation Repair Homolog 1 (E. Coli); Alkylated DNA Repair Protein AlkB Homolog 1; AlkB, Alkylation Repair Homolog (E. Coli); DNA N6-Methyl Adenin
-
AA Sequence
MLDLFADAEPWQEPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKKE
-
Predicted Molecular Mass
44.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0 or10 mM Tris-HCl, 1 mM EDTA, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. V Van Deuren, et al. Structural determinants of nucleobase modification recognition in the AlkB family of dioxygenases. DNA Repair (Amst). 2020 Dec;96:102995. [Content Brief]
[2]. B J Chen, et al. The Escherichia coli AlkB protein protects human cells against alkylation-induced toxicity. J Bacteriol. 1994 Oct;176(20):6255-61. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
