1. Recombinant Proteins
  2. Receptor Proteins
  3. Receptor Serine/Threonine Kinases
  4. Anti-Muellerian Hormone Type-2 Receptor (AMHR2)
  5. AMHR2/MISRII Protein, Human (HEK293)

AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII Protein, Human (HEK293) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293 , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII Protein, Human (HEK293) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293 , with tag free.

Background

Upon ligand binding, AMHR2/MISRII Protein assembles into a receptor complex composed of two type II and two type I transmembrane serine/threonine kinases. The type II receptors phosphorylate and activate the type I receptors, initiating their autophosphorylation. Subsequently, these activated type I receptors engage with SMAD transcriptional regulators, leading to the activation of downstream signaling pathways. Notably, AMHR2/MISRII serves as a receptor for anti-Muellerian hormone, playing a crucial role in mediating the cellular responses triggered by this hormone.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

Q16671-1 (P18-S144)

Gene ID

269  [NCBI]

Molecular Construction
N-term
AMHR2 (P18-S144)
Accession # Q16671-1
C-term
Protein Length

Partial

Synonyms
MIS type II receptor; MISRII; MRII; AMHR; MISR2; AMHR2; AMH type II receptor; AMHR2; AMHRII; C14
AA Sequence

PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES

Predicted Molecular Mass
14.3 kDa
Molecular Weight

Approximately 30-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

AMHR2/MISRII Protein, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

AMHR2/MISRII Protein, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
AMHR2/MISRII Protein, Human (HEK293)
Cat. No.:
HY-P700953
Quantity:
MCE Japan Authorized Agent: