AMHR2/MISRII Protein, Human (HEK293)
AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII Protein, Human (HEK293) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
AMHR2/MISRII Protein, upon ligand binding, forms a receptor complex with two type II and two type I kinases. Type II receptors activate type I receptors through phosphorylation, leading to autophosphorylation. Activated type I receptors engage SMAD transcriptional regulators, initiating downstream signaling pathways. Crucially, AMHR2/MISRII acts as a receptor for anti-Muellerian hormone, mediating cellular responses triggered by the hormone. AMHR2/MISRII Protein, Human (HEK293) is the recombinant human-derived AMHR2/MISRII protein, expressed by HEK293 , with tag free.
Background
Upon ligand binding, AMHR2/MISRII Protein assembles into a receptor complex composed of two type II and two type I transmembrane serine/threonine kinases. The type II receptors phosphorylate and activate the type I receptors, initiating their autophosphorylation. Subsequently, these activated type I receptors engage with SMAD transcriptional regulators, leading to the activation of downstream signaling pathways. Notably, AMHR2/MISRII serves as a receptor for anti-Muellerian hormone, playing a crucial role in mediating the cellular responses triggered by this hormone.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
Q16671-1 (P18-S144)
-
Molecular Construction
-
N-term
-
AMHR2 (P18-S144)
Accession # Q16671-1 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
AMHR2; MIS Type II Receptor; Anti-Mullerian Hormone Receptor Type 2; AMHR; MISRII; MRII; MISR2; Mullerian Inhibiting Substance Type II Receptor; Muellerian Inhibiting Substance Type II Receptor; Anti-Mullerian Hormone Receptor, Type II; Anti-Muellerian Ho
-
AA Sequence
PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
-
Predicted Molecular Mass
14.3 kDa
-
Molecular Weight
Approximately 30-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
