Copy Link Print Information

Angiopoietin-2 Protein, Human (HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Angiopoietin-2 Protein, Human (HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Angiopoietin-2 (ANGPT2) protein competes with ANGPT1 for TEK/TIE2 binding, modulates ANGPT1 signaling and induces TEK/TIE2 phosphorylation even in the absence of ANGPT1. In the absence of angiogenic stimulation, ANGPT2 disrupts cell-matrix contacts, potentially triggering endothelial cell apoptosis and vessel regression. Angiopoietin-2 Protein, Human (HEK293, His-Avi) is the recombinant human-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

The Angiopoietin-2 (ANGPT2) protein binds to TEK/TIE2, competing for the ANGPT1 binding site and thereby modulating ANGPT1 signaling. This interaction can induce the tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers, such as VEGF, ANGPT2's action leads to the loosening of cell-matrix contacts, potentially inducing endothelial cell apoptosis and consequent vascular regression. However, in the presence of VEGF, ANGPT2 collaborates to facilitate endothelial cell migration and proliferation, acting as a permissive angiogenic signal. Furthermore, ANGPT2 is involved in the regulation of lymphangiogenesis. The protein also interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and additionally interacts with ITGA5, contributing to its multifaceted role in angiogenesis and vascular regulation.

Verified Bioactivity

Immobilized Human ANGPT2 His at 2 μg/mL (100 μL/Well). Dose response curve for Anti-ANGPT2 Antibody hFc with the EC50 of 1.5-14.8 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-Avi;N-8*His
  • Accession

    O15123-1 (K275-F496)

  • Gene ID
    285  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His-Avi
    • Angiopoietin-2 (K275-F496)
      Accession # O15123-1
    • C-term
  • Protein Length

    Full Length of Fibrinogen C-terminal Domain

  • Synonyms

    ANGPT2; Angiopoietin-2a; Angiopoietin 2; Tie2-Ligand; Ang2; LMPHM10; Angiopoietin-2; AGPT2; Angiopoietin-2B; ANG-2

  • AA Sequence

    KEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

  • Predicted Molecular Mass

    28.4 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Angiopoietin-2 Protein, Human (HEK293, His-Avi) Product Image
    1/16
  • Angiopoietin-2 Protein, Human (HEK293, His-Avi) Product Image