Copy Link Print Information

Angiopoietin-2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Angiopoietin-2 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Background

Angiopoietin-2 Protein (ANGPT2) binds to TEK/TIE2 and competes with ANGPT1 for the binding site, thereby modulating ANGPT1 signaling. It has the ability to induce tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers like VEGF, ANGPT2 can cause loosening of cell-matrix contacts, potentially leading to endothelial cell apoptosis and subsequent vascular regression. However, when working in conjunction with VEGF, it can promote endothelial cell migration and proliferation, making it a permissive angiogenic signal. ANGPT2 also plays a role in the regulation of lymphangiogenesis. Additionally, it interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and interacts with ITGA5.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Angiopoietin-2 Protein, Mouse (HEK293, His) at 2 μg/mL (100 μl/well) can bind mouse TEK-Fc and the EC50 is 350-900 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-His
  • Accession

    O35608 (K275-F496)

  • Gene ID
    11601  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • Angiopoietin-2 (K275-F496)
      Accession # O35608
    • C-term
  • Protein Length

    Full Length of Fibrinogen C-terminal Domain

  • Synonyms

    ANGPT2; Angiopoietin-2a; Angiopoietin 2; Tie2-Ligand; Ang2; LMPHM10; Angiopoietin-2; AGPT2; Angiopoietin-2B; ANG-2

  • AA Sequence

    KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

  • Predicted Molecular Mass

    27.5 kDa

  • Molecular Weight

    Approximately 30-34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Angiopoietin-2 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Angiopoietin-2 Protein, Mouse (HEK293, His) Product Image