Angiopoietin-2 Protein, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Angiopoietin-2 Protein (ANGPT2) binds to TEK/TIE2 and competes with ANGPT1 for the binding site, thereby modulating ANGPT1 signaling. It has the ability to induce tyrosine phosphorylation of TEK/TIE2 even in the absence of ANGPT1. In the absence of angiogenic inducers like VEGF, ANGPT2 can cause loosening of cell-matrix contacts, potentially leading to endothelial cell apoptosis and subsequent vascular regression. However, when working in conjunction with VEGF, it can promote endothelial cell migration and proliferation, making it a permissive angiogenic signal. ANGPT2 also plays a role in the regulation of lymphangiogenesis. Additionally, it interacts with TEK/TIE2, competing for the same binding site as ANGPT1, and interacts with ITGA5.

Measured by its binding ability in a functional ELISA. Immobilized Angiopoietin-2 Protein, Mouse (HEK293, His) at 2 μg/mL (100 μl/well) can bind mouse TEK-Fc and the EC₅₀ is 350-900 ng/mL.

Mouse

HEK293

N-His

O35608 (K275-F496)

11601  [NCBI]

Partial

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Approximately 33.4 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.