Animal-Free Beta-NGF Protein, Mouse (His)

Nerve Growth Factor-β (Beta-NGF; NGF) is a neurotrophic factor that regulates neuronal survival and differentiation. NGF is also a seminal plasma protein involved in ovulation and luteinizing. NGF has potential functions in the female reproductive system to help overcome the current problem of early embryo loss^[1][2][3]. Animal-Free Beta-NGF Protein, Mouse (His) is produced by E.coli, with C-terminal His-tag.This product is for cell culture use only.

Nerve Growth Factor-β (Beta-NGF; NGF) is a basic protein of 118 amino acids which acts are a trophic factor for sensory and sympathetic neurons of the peripheral nervous system, and on cholinergic neurons of the anterior basal cerebrum^[1]. NGF involves in the regulation of neuronal survival and differentiation. Elevated levels of NGF are associated with the risk of post-traumatic stress disorder (PTSD). The trauma response leads to methylation of DNA nucleotides responsible for NGF expression. NGF levels have shown increased sympathetic fiber density proportional to NGF messenger RNA (mRNA) levels. NGF is also a seminal plasma protein commonly found in mammals. For example, NGF acts as an ovulation stimulating factor in camels and has been shown to have luteinizing effects in bulls. NGF has a potential function in the female reproductive system. For example, NGF plays an important role in ovulation induction, LH release, ovulation, luteal development, progesterone (P4) production, vascularization of luteal body, and gonadotropin response. Application of NGF to cattle enhances steroid production, luteal formation and function by increasing LH release, and leads to increased mRNA expression of markers of pregnancy and development downstream. In addition, the potential luteinizing effect of NGF could help overcome the current problem of early embryo loss^[2][3]. The similarity between human and bovine NGF protein sequence was 90.87%. Meanwhile, the similarity rate of human NGF with rat and mouse was 85.89% and 85.06%, respectively.

NGF (mouse; 4 ng/mL; 24 h) IL-6 production is induced and ALP activity and collagen biosynthesis are enhanced without affecting cell proliferation in osteoblast MC3T3-E1^[4].

Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <1 ng/mL. The specific activity of recombinant mouse beta-NGF is >1 x 10⁶ IU/mg.

Mouse

E. coli

C-6*His

P01139 (S122-G241)

18049  [NCBI]

Full Length of Mature Protein

SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5, trehalose or PBS, pH 8.0.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Castellanos MR, et al. Obtención y caracterización del beta-NGF murino. Aplicación en un modelo de envejecimiento cerebral [Obtention and characterization of murine beta-NGF. Application in a model of cerebral aging]. Rev Neurol. 1998;26(153):717-722.  [Content Brief]

  [2]. Lipov EG, et al. Possible Reversal of PTSD-Related DNA Methylation by Sympathetic Blockade. J Mol Neurosci. 2017 May;62(1):67-72.  [Content Brief]

  [3]. Lima FS, et al. Insights into nerve growth factor-β role in bovine reproduction - Review. Theriogenology. 2020 Jul 1;150:288-293.  [Content Brief]

  [4]. Yada M, et al. NGF stimulates differentiation of osteoblastic MC3T3-E1 cells. Biochem Biophys Res Commun. 1994 Dec 15;205(2):1187-93.  [Content Brief]