Copy Link Print Information

Animal-Free EGF Protein, Mouse (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free EGF Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

EGF Protein, a growth factor, is essential for cell growth, proliferation, and differentiation. It binds to the EGF receptor, activating signaling pathways that regulate cell survival and tissue repair. EGF Protein has therapeutic potential in promoting wound healing, tissue regeneration, and cancer treatment. Its role in cellular processes makes it a subject of interest in biomedical research. Animal-Free EGF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeEGF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

EGF is a potent growth factor that promotes the proliferation of various epidermal and epithelial tissues both in vivo and in vitro, as well as certain fibroblasts in cell culture. It acts as a magnesiotropic hormone by stimulating the reabsorption of magnesium in the renal distal convoluted tubule through the activation of EGFR and the magnesium channel TRPM6. EGF also interacts with EGFR, facilitating EGFR dimerization, and forms interactions with RHBDF1 and RHBDF2, potentially regulating its intracellular localization and degradation.

Verified Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <80 pg/mL. The specific activity of recombinant mouse EGF is approximately >1x106 IU/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag C-6*His
  • Accession

    P01132 (N977-R1029)

  • Gene ID
    13645  [NCBI]
  • Molecular Construction
    • N-term
    • EGF (N977-R1029)
      Accession # P01132
    • 6*His
    • C-term
  • Protein Length

    Full Length of EGF

  • Synonyms

    EGF; Alternative Protein EGF; Epidermal Growth Factor; Beta-Urogastrone; Pro-Epidermal Growth Factor; HOMG4; Epidermal Growth Factor (Beta-Urogastrone); URG

  • AA Sequence

    NSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQTRDLRWWELR

  • Predicted Molecular Mass

    7 kDa

  • Molecular Weight

    Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 8.0, trehalose or PBS, pH 8.0.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free EGF Protein, Mouse (His) Product Image
    1/16
  • Animal-Free EGF Protein, Mouse (His) Product Image