Copy Link Print Information

Animal-Free FGF-16 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

FGF-16 Protein orchestrates embryonic development, regulating cell proliferation and differentiation. Its vital role in cardiomyocyte proliferation and heart development becomes evident through intricate interactions with FGFR1 and FGFR2. Forming essential molecular connections, FGF-16 contributes to signaling pathways crucial for embryonic development and cellular processes. Animal-Free FGF-16 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-16 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free FGF-16 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-16 Protein orchestrates embryonic development, regulating cell proliferation and differentiation. Its vital role in cardiomyocyte proliferation and heart development becomes evident through intricate interactions with FGFR1 and FGFR2. Forming essential molecular connections, FGF-16 contributes to signaling pathways crucial for embryonic development and cellular processes. Animal-Free FGF-16 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-16 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

FGF-16 Protein assumes a pivotal role in orchestrating embryonic development, exerting regulatory influence over critical processes such as cell proliferation and differentiation. Its indispensability becomes evident in the intricate realm of cardiomyocyte proliferation and heart development, where FGF-16 plays a vital role. The protein intricately interacts with FGFR1 and FGFR2, forming essential molecular connections that contribute to the orchestration of signaling pathways crucial for embryonic development and cellular processes.

Verified Bioactivity

Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is <31 ng/mL. The specific activity of recombinant human FGF-16 is >3 x 104 IU/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    O43320 (A2-R207)

  • Gene ID
    8823  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-16 (A2-R207)
      Accession # O43320
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FGF16; FGF-16; Prev. MF4; FGF; Metacarpal 4-5 Fusion; Fibroblast Growth Factor 16; Fibroblast Growth Factor

  • AA Sequence

    AEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR

  • Predicted Molecular Mass

    24.6 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free FGF-16 Protein, Human (His) Product Image
    1/16
  • Animal-Free FGF-16 Protein, Human (His) Product Image