Animal-Free FGF-16 Protein, Human (His)

FGF-16 Protein orchestrates embryonic development, regulating cell proliferation and differentiation. Its vital role in cardiomyocyte proliferation and heart development becomes evident through intricate interactions with FGFR1 and FGFR2. Forming essential molecular connections, FGF-16 contributes to signaling pathways crucial for embryonic development and cellular processes. Animal-Free FGF-16 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-16 protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free FGF-16 Protein, Human (His) is 207 a.a., with molecular weight of ~24.57 kDa.

FGF-16 Protein assumes a pivotal role in orchestrating embryonic development, exerting regulatory influence over critical processes such as cell proliferation and differentiation. Its indispensability becomes evident in the intricate realm of cardiomyocyte proliferation and heart development, where FGF-16 plays a vital role. The protein intricately interacts with FGFR1 and FGFR2, forming essential molecular connections that contribute to the orchestration of signaling pathways crucial for embryonic development and cellular processes.

Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <31 ng/mL. The specific activity of recombinant human FGF-16 is >3 x 10⁴ IU/mg.

Human

E. coli

C-His

O43320 (A1-R207)

8823  [NCBI]

MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR

Approximately 24.57 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 1X PBS, pH 7.4.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.