Copy Link Print Information

Animal-Free FGF-19 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. Animal-Free FGF-19 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Animal-Free FGF-19 Protein, Human (His)
  • Experimental Validation Results for Animal-Free FGF-19 Protein, Human (His)
  • Animal-Free FGF-19 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. Animal-Free FGF-19 Protein, Human (His) is the recombinant human-derived animal-FreeFGF-19 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The FGF-19 Protein plays a pivotal role in the regulation of bile acid biosynthesis by suppressing CYP7A1 expression through the positive modulation of the JNK and ERK1/2 cascades. Additionally, FGF-19 stimulates glucose uptake in adipocytes, and its activity is contingent upon the presence of both KLB and FGFR4. The protein forms crucial interactions with FGFR1, FGFR2, FGFR3, and FGFR4, emphasizing its involvement in FGF receptor signaling pathways. The affinity between FGFs and their receptors is augmented by KL, KLB, and heparan sulfate glycosaminoglycans, acting as coreceptors. FGF-19 directly interacts with KL and KLB, and in the presence of heparin, KL, or KLB, it forms an interaction with FGFR4. Additionally, FGF-19 interacts with MALRD1, highlighting its diverse molecular associations and suggesting its involvement in intricate cellular processes.

Verified Bioactivity

1.Measure by its ability to induce NIH-3T3 cells proliferation. The ED50 for this effect is <51 ng/mL.
2.Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 39.06 ng/mL, corresponding to a specific activity is 2.56×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 39.06 ng/mL, corresponding to a specific activity is 2.56×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    O95750 (R23-K216)

  • Gene ID
    9965  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-19 (R23-K216)
      Accession # O95750
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF19; Fibroblast Growth Factor; Fibroblast Growth Factor 19; FGF; FGF-19

  • AA Sequence

    RPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

  • Predicted Molecular Mass

    22.6 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/c 3T3 cells. The ED50 for this effect is 39.06 ng/mL, corresponding to a specific activity is 2.56×104 units/mg.

  • Animal-Free FGF-19 Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for Animal-Free FGF-19 Protein, Human (His)
  • Experimental Validation Results for Animal-Free FGF-19 Protein, Human (His)
  • Animal-Free FGF-19 Protein, Human (His) Product Image