Animal-Free IGF-I Protein, Pig (His)
The IGF-I protein is structurally similar to insulin and has excellent growth-promoting activity. As a potential physiological regulator, it affects [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Animal-Free IGF-I Protein, Pig (His) is the recombinant pig-derived animal-FreeIGF-I protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Pig
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IGF-I protein is structurally similar to insulin and has excellent growth-promoting activity. As a potential physiological regulator, it affects [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Animal-Free IGF-I Protein, Pig (His) is the recombinant pig-derived animal-FreeIGF-I protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
The IGF-I protein, sharing structural and functional similarities with insulin, surpasses its counterpart in growth-promoting activity. It potentially acts as a physiological regulator, influencing [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Demonstrating efficacy in stimulating glucose transport in bone-derived osteoblastic (PyMS) cells at significantly lower concentrations than insulin, IGF-I extends its impact to glycogen and DNA synthesis, as well as enhanced glucose uptake. With a potential role in synapse maturation, IGF-I is implicated in Ca(2+)-dependent exocytosis essential for sensory perception of smell in the olfactory bulb. Functioning as a ligand for IGF1R, it binds to the alpha subunit, initiating the activation of intrinsic tyrosine kinase activity, leading to a cascade of downstream signaling events, including the activation of the PI3K-AKT/PKB and Ras-MAPK pathways. Essential for IGF1 signaling, IGF-I forms crucial ternary complexes with integrins (ITGAV:ITGB3 and ITGA6:ITGB4) and IGFR1, influencing the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2, and AKT1.
Technical Parameters
-
Species Pig
-
Source E. coli
-
Tag C-6*His
-
Accession
P16545 (G49-A118)
-
Molecular Construction
-
N-term
-
IGF-I (G49-A118)
Accession # P16545 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like
-
AA Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
-
Predicted Molecular Mass
9.4 kDa
-
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
